![Western Blot: FZR1/CDH1 Antibody [NBP3-38164] - Western blot analysis of lysates from 293T cells, using FZR1/CDH1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-38164_rabbit-fzr1-cdh1-pab-1012202411421066.jpg "Western Blot: FZR1/CDH1 Antibody [NBP3-38164] - Western blot analysis of lysates from 293T cells, using FZR1/CDH1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 224-493 of human FZR1/CDH1 (NP_057347.2). Sequence: DLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFTRIR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FZR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FZR1/CDH1 Antibody (NBP3-38164)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FZR1 |
![Immunocytochemistry/ Immunofluorescence: FZR1/CDH1 Antibody [NBP3-38164] - Immunofluorescence analysis of HeLa cells using FZR1/CDH1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-38164_rabbit-fzr1-cdh1-pab-1012202411353070.jpg "Immunocytochemistry/ Immunofluorescence: FZR1/CDH1 Antibody [NBP3-38164] - Immunofluorescence analysis of HeLa cells using FZR1/CDH1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Immunohistochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Immunohistochemistry_15873.jpg)
![Immunocytochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-13_AF3264_Immunocytochemistry_6491.jpg)
![Simple Western Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Simple_Western_17005.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")