![Western Blot: Fucosyltransferase 7/FUT7 Antibody [NBP3-02941] - Analysis of extracts of various cell lines, using Fucosyltransferase 7/FUT7 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Fucosyltransferase-7-FUT7-Antibody-Western-Blot-NBP3-02941-img0001.jpg "Western Blot: Fucosyltransferase 7/FUT7 Antibody [NBP3-02941] - Analysis of extracts of various cell lines, using Fucosyltransferase 7/FUT7 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Fucosyltransferase 7/FUT7 (NP_004470.1). TRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FUT7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunohistochemistry_6938.jpg)
![Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunocytochemistry_9821.jpg)
![Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/bba16_human-e-selectin-cd62e-mab-clone-bbig-e4-flow-cytometry-25102021144214.jpg)
![Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]](https://images.novusbio.com/images/antibody/bba24_human-l-selectin-cd62l-mab-cl-4g8-flow-cytometry-822024174319..jpg)
![Immunohistochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunohistochemistry_22592.jpg)
![Immunocytochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunocytochemistry_12684.jpg)
![Western Blot Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Western_Blot_12747.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Fucosyltransferase 7/FUT7 Antibody (NBP3-02941)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FUT7 |
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")