![Immunocytochemistry/Immunofluorescence: FoxM1 Antibody (2H4) [H00002305-M05] - Analysis of monoclonal antibody to FOXM1 on HeLa cell. Antibody concentration 20 ug/ml](http://images.novusbio.com/fullsize/FoxM1-Antibody-2H4-Immunocytochemistry-Immunofluorescence-H00002305-M05-img0001.jpg "Immunocytochemistry/Immunofluorescence: FoxM1 Antibody (2H4) [H00002305-M05] - Analysis of monoclonal antibody to FOXM1 on HeLa cell. Antibody concentration 20 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2H4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS |
| Marker | Mitosis Marker |
| Specificity | FOXM1 (2H4) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | FOXM1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FoxM1 Antibody (H00002305-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: FoxM1 Antibody (2H4) [H00002305-M05] - Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/FoxM1-Antibody-2H4-ELISA-H00002305-M05-img0003.jpg "ELISA: FoxM1 Antibody (2H4) [H00002305-M05] - Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Chromatin_Immunoprecipitation_11227.jpg)
![Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Immunocytochemistry_6484.jpg)
![Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF3_beta_AF2400_Immunohistochemistry_23167.jpg)
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
