FMNL3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human FMNL3. Peptide sequence: EKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYEGKDGTI The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FMNL3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for FMNL3 Antibody
Background
FMNL3, also known as Formin-like protein 3, has 3 isoforms, a 1,028 amino acid isoform that is 117 kDs, a 976 amino acid isoform that is 111 kDa and a 1,027 amino acid isoform that is 117 kDa, plays an important role in the regulation of cell morphology and cytoskeletal organization and is required in the control of cell shape and migration. Disease research is currently being studied with relation to FMNL3 and chondrosarcoma and glioblastoma. This protein has been linked to the cytoskeleton organization, actin cytoskeleton organization, regulation of cell shape, cellular component organization, and cell migration pathways in interaction with PRPF40A and YWHAB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Block, IHC
Publications for FMNL3 Antibody (NBP2-87452) (0)
There are no publications for FMNL3 Antibody (NBP2-87452).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FMNL3 Antibody (NBP2-87452) (0)
There are no reviews for FMNL3 Antibody (NBP2-87452).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FMNL3 Antibody (NBP2-87452) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FMNL3 Products
Blogs on FMNL3