![Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in human placenta.](http://images.novusbio.com/fullsize/FKBP51-FKBP5-Antibody-Western-Blot-H00002289-B01P-img0003.jpg "Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in human placenta.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | FKBP5 (NP_004108.1, 1 a.a. - 457 a.a.) full-length human protein. MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | FKBP5 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for WB, Functional, IF and IHC-P. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FKBP5/FKBP51 Antibody (H00002289-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FKBP5 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/FKBP51-FKBP5-Antibody-Immunocytochemistry-Immunofluorescence-H00002289-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/FKBP51-FKBP5-Antibody-Immunohistochemistry-Paraffin-H00002289-B01P-img0002.jpg "Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)")
![Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in transfected 293T cell line by FKBP5 polyclonal antibody. Lane 1: FKBP5 transfected lysate(50.27 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/FKBP51-FKBP5-Antibody-Western-Blot-H00002289-B01P-img0004.jpg "Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in transfected 293T cell line by FKBP5 polyclonal antibody. Lane 1: FKBP5 transfected lysate(50.27 KDa). Lane 2: Non-transfected lysate.")
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")