FKBP12.6 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP12.6 (NP_473374.1). MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FKBP1B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for FKBP12.6 Antibody - Azide and BSA Free
Background
The protein encoded by the FKBP1B gene is a member of the immunophilin protein family, which play a role in immunoregulationand basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolylisomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A.Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are twoalternatively spliced transcript variants of this gene encoding different isoforms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for FKBP12.6 Antibody (NBP3-02968) (0)
There are no publications for FKBP12.6 Antibody (NBP3-02968).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FKBP12.6 Antibody (NBP3-02968) (0)
There are no reviews for FKBP12.6 Antibody (NBP3-02968).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FKBP12.6 Antibody (NBP3-02968) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FKBP12.6 Products
Research Areas for FKBP12.6 Antibody (NBP3-02968)
Find related products by research area.
|
Blogs on FKBP12.6