![Western Blot: FIP1L1 Antibody [NBP1-85064] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Western-Blot-NBP1-85064-img0013.jpg "Western Blot: FIP1L1 Antibody [NBP1-85064] - Analysis in human cell line MOLT-4.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPT |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FIP1L1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FIP1L1 |
![Immunocytochemistry/Immunofluorescence: FIP1L1 Antibody [NBP1-85064] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85064-img0012.jpg "Immunocytochemistry/Immunofluorescence: FIP1L1 Antibody [NBP1-85064] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human placents shows moderate to strong nuuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-85064-img0017.jpg "Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human placents shows moderate to strong nuuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-85064-img0014.jpg "Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human cerebellum shows strong nuclear postivity in all layers.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-85064-img0018.jpg "Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human cerebellum shows strong nuclear postivity in all layers.")
![Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human kidnewy shows strong nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/FIP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-85064-img0019.jpg "Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human kidnewy shows strong nuclear positivity in cells in tubules.")
![Western Blot PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Western_Blot_20935.jpg)
![Immunohistochemistry PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Immunohistochemistry_6673.jpg)
![Neutralization PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Block_Neutralize_8750.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Immunohistochemistry_6669.jpg)
![Western Blot PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Western_Blot_17545.jpg)
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images/af1042_mouse-pdgf-r-beta-affinity-purified-polyclonal-ab-41202410481131.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")