Home » ESD » ESD Proteins » ESD Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ESD Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ESD Protein (NBP1-89479PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ESD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ESD.

Source: E. coli

Amino Acid Sequence: HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ESD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89479.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ESD Recombinant Protein Antigen

  • EC 3.1.2.12
  • esterase 10
  • esterase Desterase D/formylglutathione hydrolase
  • FGH
  • FLJ11763
  • S-formylglutathione hydrolase

Background

ESD encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glyoxalase I
Antibody (Glo1a)
NBP1-19015
Simple Western Glyoxalase I Antibody (Glo1a)
Western Blot Glyoxalase I Antibody (Glo1a)
Immunocytochemistry/ Immunofluorescence Glyoxalase I Antibody (Glo1a)
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
PGM1 Antibody
(3B8-H4)
H00005236-M01
Western Blot PGM1 Antibody (3B8-H4)
Immunocytochemistry/ Immunofluorescence PGM1 Antibody (3B8-H4)
Immunoprecipitation PGM1 Antibody (3B8-H4)
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
PGD Antibody
NBP1-31589
Western Blot PGD Antibody
Immunohistochemistry-Paraffin PGD Antibody
Immunocytochemistry/ Immunofluorescence PGD Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(51 Publications)
Species: Hu
Applications: BA
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
LMW-PTP/ACP1
Antibody
AF5075
Western Blot LMW-PTP/ACP1 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: WB
PHGDH Antibody
NBP1-87311
Western Blot PHGDH Antibody
Simple Western PHGDH Antibody
Immunohistochemistry-Paraffin PHGDH Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(27 Publications)
Species: Hu
Applications: ELISA
GPT Antibody
NBP1-89111
Western Blot GPT Antibody
Immunohistochemistry-Paraffin GPT Antibody
Immunohistochemistry-Paraffin GPT Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
DPAGT1 Antibody -
BSA Free
NBP2-81923
Western Blot DPAGT1 Antibody - BSA Free
Immunohistochemistry DPAGT1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DPAGT1 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Adenylate Kinase 1
Antibody
NBP1-87401
Immunocytochemistry/ Immunofluorescence Adenylate Kinase 1 Antibody
Immunohistochemistry-Paraffin Adenylate Kinase 1 Antibody
Immunohistochemistry-Paraffin Adenylate Kinase 1 Antibody
(1 Review)
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
UBR5/EDD Antibody
NB100-1591
Immunohistochemistry-Paraffin UBR5/EDD Antibody
Immunohistochemistry-Paraffin UBR5/EDD Antibody
Western Blot UBR5/EDD Antibody
(10 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
ESD Recombinant
Protein Antigen
NBP1-89479PEP
ESD Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ESD Protein (NBP1-89479PEP) (0)

There are no publications for ESD Protein (NBP1-89479PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESD Protein (NBP1-89479PEP) (0)

There are no reviews for ESD Protein (NBP1-89479PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ESD Protein (NBP1-89479PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ESD Products

Array NBP1-89479PEP

Blogs on ESD

There are no specific blogs for ESD, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ESD Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ESD