![Western Blot: ESD Antibody (1E1) [H00002098-M01] - ESD monoclonal antibody (M01), clone 1E1. Analysis of ESD expression in Jurkat.](http://images.novusbio.com/fullsize/ESD-Antibody-1E1-Western-Blot-H00002098-M01-img0005.jpg "Western Blot: ESD Antibody (1E1) [H00002098-M01] - ESD monoclonal antibody (M01), clone 1E1. Analysis of ESD expression in Jurkat.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1E1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ESD (NP_001975.1, 183 a.a. ~ 281 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN |
| Specificity | ESD - esterase D/formylglutathione hydrolase (1E1) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ESD |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00002098-M01 | Applications | Species |
|---|---|---|
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: ESD Antibody (1E1) [H00002098-M01] - Detection limit for recombinant GST tagged ESD is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ESD-Antibody-1E1-Sandwich-ELISA-H00002098-M01-img0004.jpg "Sandwich ELISA: ESD Antibody (1E1) [H00002098-M01] - Detection limit for recombinant GST tagged ESD is approximately 1ng/ml as a capture antibody.")
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
