![Western Blot: ERP29 Antibody (1J0D3) [NBP3-15906] - Western blot analysis of extracts of various cell lines, using ERP29 Rabbit mAb (NBP3-15906) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/ERP29-Antibody-1J0D3-Western-Blot-NBP3-15906-img0004.jpg "Western Blot: ERP29 Antibody (1J0D3) [NBP3-15906] - Western blot analysis of extracts of various cell lines, using ERP29 Rabbit mAb (NBP3-15906) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 1J0D3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERP29 (P30040). MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | ERP29 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ERP29 Antibody (NBP3-15906)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERP29 |
![Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded mouse brain using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ERP29-Antibody-1J0D3-Immunohistochemistry-Paraffin-NBP3-15906-img0003.jpg "Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded mouse brain using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded rat lung using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ERP29-Antibody-1J0D3-Immunohistochemistry-Paraffin-NBP3-15906-img0001.jpg "Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded rat lung using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded human placenta using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ERP29-Antibody-1J0D3-Immunohistochemistry-Paraffin-NBP3-15906-img0002.jpg "Immunohistochemistry-Paraffin: ERP29 Antibody (1J0D3) [NBP3-15906] - Immunohistochemistry of paraffin-embedded human placenta using ERP29 Rabbit mAb (NBP3-15906) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded rat kidney tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15906_rabbit-erp29-mab-1j0d3-52202517172858.jpg%3Ft=1705994142 "Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded rat kidney tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded mouse brain tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15906_rabbit-erp29-mab-1j0d3-52202517202966.jpg%3Ft=1705994142 "Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded mouse brain tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human colon carcinoma tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15906_rabbit-erp29-mab-1j0d3-5220251716234.jpg%3Ft=1705994142 "Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human colon carcinoma tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human liver tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15906_rabbit-erp29-mab-1j0d3-52202517172810.jpg%3Ft=1705994142 "Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human liver tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human breast cancer tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15906_rabbit-erp29-mab-1j0d3-52202517284970.jpg%3Ft=1705994142 "Immunohistochemistry: ERP29 Antibody (1J0D3) [ERP29] - Immunohistochemistry analysis of ERP29 in paraffin-embedded human breast cancer tissue using ERP29 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Western_Blot_5379.jpg)
![Knockout Validated PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Knockout_Validated_22482.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images/af3999_human-perk-affinity-purified-polyclonal-ab-4120241240258.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")