![Western Blot: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Western blot analysis of extracts of various cell lines, using Ephrin-B2 Rabbit mAb (NBP3-15372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-1G9E7-Western-Blot-NBP3-15372-img0002.jpg "Western Blot: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Western blot analysis of extracts of various cell lines, using Ephrin-B2 Rabbit mAb (NBP3-15372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 1G9E7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EFNB2 (P52799). MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | EFNB2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Ephrin-B2 Antibody (NBP3-15372)Find related products by research area.
|
|
Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EFNB2 |
![Immunohistochemistry-Paraffin: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Immunohistochemistry of paraffin-embedded rat heart using Ephrin-B2 Rabbit mAb (NBP3-15372) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-1G9E7-Immunohistochemistry-Paraffin-NBP3-15372-img0001.jpg "Immunohistochemistry-Paraffin: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Immunohistochemistry of paraffin-embedded rat heart using Ephrin-B2 Rabbit mAb (NBP3-15372) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Western blot analysis of extracts of various cell lines, using Ephrin-B2 Rabbit mAb (NBP3-15372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-1G9E7-Western-Blot-NBP3-15372-img0003.jpg "Western Blot: Ephrin-B2 Antibody (1G9E7) [NBP3-15372] - Western blot analysis of extracts of various cell lines, using Ephrin-B2 Rabbit mAb (NBP3-15372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![Western Blot EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Western_Blot_17606.jpg)
![Immunocytochemistry EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Immunocytochemistry__Immunofluorescence_20119.jpg)
![Western Blot Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Western_Blot_17536.jpg)
![Immunohistochemistry Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ephrin-B1_AF473_Immunohistochemistry_7180.jpg)
![Simple Western Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Simple_Western_18962.jpg)
![Western Blot Ephrin-B3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB3_AF395_Western_Blot_16885.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![EphB1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "EphB1 [Unconjugated]")
![Immunocytochemistry EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Immunocytochemistry_10108.jpg)
![Western Blot EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Western_Blot_23994.jpg)
![Western Blot DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Western_Blot_15836.jpg)
![Immunocytochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunocytochemistry_15887.jpg)
![Immunohistochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunohistochemistry_24173.jpg)
![Immunohistochemistry Ephrin-A4 Antibody (135305) [Unconjugated]](https://images.novusbio.com/images2/EphrinA4_MAB369_Immunohistochemistry_21487.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Knockout_Validated_21256.jpg)
![Immunohistochemistry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Immunohistochemistry_7327.jpg)
![Flow Cytometry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Flow_Cytometry_20077.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")