ENPP-3/CD203c Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ENPP3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Simple Western
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Simple Western reported by internal validation: Tested in human endometrium, uterus and uterine fluid; separated by size; antibody dilution of 1:50. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ENPP-3/CD203c Antibody
Background
The ENPP3 gene encodes a 875 amino acid long, 100 kDA ectonucleotide pyrophosphatase/phosphodiesterase family member 3 protein that separates multiple phosphodiester and phosphosulfate bonds, specifically in deoxynucleotides, nucleotide sugars, and NAD. ENPP3 participates in NAD metabolism, purine metabolism, riboflavin metabolism, and pantothenate and CoA biosynthesis. ENPP3 has been linked to carcinoma, bile duct cancer, urticaria, retinitis, epididymitis, prostatitis, urticaria, and asthma as it interacts with genes GRB2, CD38, NADK, BST1, and ACPP.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, IHC
Publications for ENPP-3/CD203c Antibody (NBP1-88928) (0)
There are no publications for ENPP-3/CD203c Antibody (NBP1-88928).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ENPP-3/CD203c Antibody (NBP1-88928) (0)
There are no reviews for ENPP-3/CD203c Antibody (NBP1-88928).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ENPP-3/CD203c Antibody (NBP1-88928) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ENPP-3/CD203c Products
Research Areas for ENPP-3/CD203c Antibody (NBP1-88928)
Find related products by research area.
|
Blogs on ENPP-3/CD203c