![Western Blot: EHD4 Antibody [NBP1-54873] - Trafficking proteins levels in hippocampus of 11 months old rats exposed to rotenone (ROT, 1 mg/kg/day) or DMSO (control), during 8 weeks, and exercised during 6 weeks (EXE) or left sedentary (SED). Representative images of immunoblot bands corresponding to SLP-1, Rab27B, CRPM-2, KIF1B, EDH-4, Dynactin, Dynein and beta-actin. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2451830116300036) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/EHD4-Antibody-Western-Blot-NBP1-54873-img0007.jpg "Western Blot: EHD4 Antibody [NBP1-54873] - Trafficking proteins levels in hippocampus of 11 months old rats exposed to rotenone (ROT, 1 mg/kg/day) or DMSO (control), during 8 weeks, and exercised during 6 weeks (EXE) or left sedentary (SED). Representative images of immunoblot bands corresponding to SLP-1, Rab27B, CRPM-2, KIF1B, EDH-4, Dynactin, Dynein and beta-actin. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2451830116300036) licensed under a CC-BY license.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EHD4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Western_Blot_16272.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16281.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16416.jpg)
![Immunohistochemistry TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Immunohistochemistry_10167.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_23433.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_19007.jpg)
| Publication using NBP1-54873 | Applications | Species |
|---|---|---|
| Almeida M F, Chaves R S et al. BDNF trafficking and signaling impairment during early neurodegeneration is prevented by moderate physical activity. IBRO Rep 2016-01-12 [PMID: 30135925] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Human Thyroid lysate tissue at an antibody concentration of 5.0 ug/ml using anti-EHD4 antibody](http://images.novusbio.com/fullsize/EHD4-Antibody-Immunohistochemistry-NBP1-54873-img0004.jpg "Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Human Thyroid lysate tissue at an antibody concentration of 5.0 ug/ml using anti-EHD4 antibody")
![Western Blot: EHD4 Antibody [NBP1-54873] - Reccomended Titration: 1 ug/ml Positive Control: Fetal Lung cell lysate](http://images.novusbio.com/fullsize/EHD4-Antibody-Western-Blot-NBP1-54873-img0006.jpg "Western Blot: EHD4 Antibody [NBP1-54873] - Reccomended Titration: 1 ug/ml Positive Control: Fetal Lung cell lysate")
![Western Blot: EHD4 Antibody [NBP1-54873] - Sample Tissue: Human 786-0 Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/EHD4-Antibody-Western-Blot-NBP1-54873-img0005.jpg "Western Blot: EHD4 Antibody [NBP1-54873] - Sample Tissue: Human 786-0 Antibody Dilution: 1.0 ug/ml")
![Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Staining of human Thyroid.](http://images.novusbio.com/fullsize/EHD4-Antibody-Immunohistochemistry-NBP1-54873-img0003.jpg "Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Staining of human Thyroid.")
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Western Blot ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Western_Blot_5217.jpg)
![Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Immunocytochemistry__Immunofluorescence_19361.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")