Home » EGLN2/PHD1 » EGLN2/PHD1 Proteins » EGLN2/PHD1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

EGLN2/PHD1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EGLN2/PHD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGLN2/PHD1.

Source: E. coli

Amino Acid Sequence: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EGLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76551.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EGLN2/PHD1 Recombinant Protein Antigen

  • DKFZp434E026
  • EC 1.14.11
  • EC 1.14.11.-
  • egl nine homolog 2 (C. elegans)
  • egl nine homolog 2
  • EGLN2
  • EIT6
  • Estrogen-induced tag 6
  • FLJ95603
  • HIFPH1 EGL nine (C.elegans) homolog 2
  • HIFPH1
  • HIF-PH1
  • HIF-prolyl hydroxylase 1
  • HPH-1
  • HPH-3
  • Hypoxia-inducible factor prolyl hydroxylase 1
  • PHD1
  • Prolyl hydroxylase domain-containing protein 1

Background

HIF prolyl hydroxylase 1 (HPH-3 or EGLN2) is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the HPH sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. HPH is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, HPHs convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGLN1/PHD2 Antibody
NB100-137
Flow Cytometry EGLN1/PHD2 Antibody
Western Blot EGLN1/PHD2 Antibody
Immunohistochemistry EGLN1/PHD2 Antibody
(12 Reviews)
(92 Publications)
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
EGLN3/PHD3
Antibody - BSA Free
NB100-139
Knockdown Validated EGLN3/PHD3 Antibody - BSA Free
Knockdown Validated EGLN3/PHD3 Antibody - BSA Free
Western Blot EGLN3/PHD3 Antibody - BSA Free
(2 Reviews)
(53 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1043 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Immunocytochemistry/ Immunofluorescence ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
(4 Reviews)
(106 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
HYPB Antibody -
Azide and BSA Free
NBP3-03807
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Western Blot HYPB Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
GCH1 Antibody
NBP1-84949
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(826 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
FIH-1/HIF-1AN
Antibody
NB100-428
Western Blot FIH-1/HIF-1AN Antibody
Western Blot FIH-1/HIF-1AN Antibody
Immunohistochemistry FIH-1/HIF-1AN Antibody
(3 Reviews)
(29 Publications)
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
(1 Review)
(21 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
EDR1/PHC1 Antibody
(1F3F3) - BSA Free
NBP2-37371
ELISA EDR1/PHC1 Antibody (1F3F3) - BSA Free
Western Blot EDR1/PHC1 Antibody (1F3F3) - BSA Free
Western Blot EDR1/PHC1 Antibody (1F3F3) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
EGLN2/PHD1
Recombinant Protein A
NBP2-76551PEP
EGLN2/PHD1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGLN2/PHD1 Products

Research Areas for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP)

Find related products by research area.

Blogs on EGLN2/PHD1

There are no specific blogs for EGLN2/PHD1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105
Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
HIF-2 alpha/EPAS1 Antibody - BSA Free
NB100-122

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EGLN2/PHD1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EGLN2