![Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/eEF1A1-Antibody-Western-Blot-NBP2-92880-img0005.jpg "Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 301-400 of human eEF1A1 (NP_001393.1). EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EEF1A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for eEF1A1 Antibody (NBP2-92880)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EEF1A1 |
![Immunocytochemistry/Immunofluorescence: eEF1A1 Antibody [NBP2-92880] - Analysis of Raw264.7 cells using eEF1A1 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/eEF1A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92880-img0001.jpg "Immunocytochemistry/Immunofluorescence: eEF1A1 Antibody [NBP2-92880] - Analysis of Raw264.7 cells using eEF1A1 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded rat ovary using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0004.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded rat ovary using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/eEF1A1 Antibody-Western Blot-NBP2-92880-img0006.jpg "Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse brain using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0002.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse brain using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse kidney using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0003.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse kidney using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")