![Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Western-Blot-NBP2-13926-img0005.jpg "Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLD |
![Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13926-img0006.jpg "Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunohistochemistry-Paraffin-NBP2-13926-img0008.jpg "Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human kidney shows high expression.")
![Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Western-Blot-NBP2-13926-img0004.jpg "Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human epididymis shows low expression as expected.](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunohistochemistry-Paraffin-NBP2-13926-img0007.jpg "Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human epididymis shows low expression as expected.")
![Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining in human kidney and epididymis tissues using anti-DLD antibody. Corresponding DLD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunohistochemistry-Paraffin-NBP2-13926-img0009.jpg "Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining in human kidney and epididymis tissues using anti-DLD antibody. Corresponding DLD RNA-seq data are presented for the same tissues.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")