![Western Blot: DENND1C Antibody [NBP1-94052] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/DENND1C-Antibody-Western-Blot-NBP1-94052-img0006.jpg "Western Blot: DENND1C Antibody [NBP1-94052] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DENND1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot DENND3 [p Ser554] Antibody](https://images.novusbio.com/images/DENND3-[p-Ser554]-Antibody-Western-Blot-NBP2-60771-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DENND1C |
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human colon.](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0011.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human colon.")
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0002.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.")
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0007.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining in human lymph node and liver tissues using anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0008.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining in human lymph node and liver tissues using anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow, colon, liver and lymph node using Anti-DENND1C antibody NBP1-94052 (A) shows similar protein distribution across tissues to independent antibody NBP1-94051 (B).](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0009.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow, colon, liver and lymph node using Anti-DENND1C antibody NBP1-94052 (A) shows similar protein distribution across tissues to independent antibody NBP1-94051 (B).")
![Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow.](http://images.novusbio.com/fullsize/DENND1C-Antibody-Immunohistochemistry-Paraffin-NBP1-94052-img0010.jpg "Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow.")
![Simple Western Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Simple_Western_16531.jpg)
![Knockout Validated Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Knockout_Validated_23042.jpg)
![Immunohistochemistry Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Immunohistochemistry_12950.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")