| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cytokeratin 7. Source: E. coli Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G). Source: E. coli Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | KRT7 |
| Purity | >80%, by SDS-PAGE |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-88919. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80%, by SDS-PAGE |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Research Areas for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KRT7 |
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![Simple Western: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Lane view shows a specific band for Cytokeratin 7 at 5 ug/mL in HeLa cell lysate.Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 61 kDa. Image from an internal validation.](https://images.novusbio.com/images/Cytokeratin-7-Antibody-OV-TL12-30-Azide-and-BSA-Free-Simple-Western-NBP2-47940-img0002.jpg "Simple Western: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Lane view shows a specific band for Cytokeratin 7 at 5 ug/mL in HeLa cell lysate.Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 61 kDa. Image from an internal validation.")