Home » Cytokeratin 3 » Cytokeratin 3 Proteins » Recombinant Human Cytokeratin 3 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Cytokeratin 3 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Cytokeratin 3 Protein [H00003850-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Cytokeratin 3 Protein [H00003850-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Cytokeratin 3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-289 of Human Cytokeratin 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KRT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytokeratin 3 GST (N-Term) Protein

  • CK3
  • CK-3
  • cytokeratin-3
  • FLJ95909
  • K3cytokeratin 3
  • keratin 3
  • keratin, type II cytoskeletal 3,65 kDa cytokeratin
  • Keratin-3
  • Type-II keratin Kb3

Background

The protein encoded by the Cytokeratin 3 gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmann's Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CKAP4/p63 Antibody
[Unconjugated]
AF7355
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
Western Blot CKAP4/p63 Antibody [Unconjugated]
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC Cytokeratin, pan Antibody (AE-1/AE-3)
CyTOF-reported Cytokeratin, pan Antibody (AE-1/AE-3)
Flow Cytometry Cytokeratin, pan Antibody (AE-1/AE-3)
(1 Review)
(67 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
SECTM1
[Unconjugated]
7559-ST
SECTM1 [Unconjugated]
Species: Hu
Applications: BA
UVRAG Antibody
NBP1-18885
Immunohistochemistry-Paraffin UVRAG Antibody
Western Blot UVRAG Antibody
Western Blot UVRAG Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(98 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry Cytokeratin 19 Antibody - BSA Free
Western Blot Cytokeratin 19 Antibody - BSA Free
Immunohistochemistry Cytokeratin 19 Antibody - BSA Free
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Cytokeratin 4
Antibody (SN74-03)
NBP2-67706
Flow Cytometry Cytokeratin 4 Antibody (SN74-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 4 Antibody (SN74-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 4 Antibody (SN74-03)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Cytokeratin 5
Antibody - BSA Free
NBP2-61931
Immunocytochemistry/ Immunofluorescence Cytokeratin 5 Antibody - BSA Free
Western Blot Cytokeratin 5 Antibody - BSA Free
Immunohistochemistry-Paraffin Cytokeratin 5 Antibody - BSA Free
(2 Publications)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Flow Cytometry Cytokeratin 14 Antibody (LL002)
Immunocytochemistry/ Immunofluorescence Cytokeratin 14 Antibody (LL002)
Immunohistochemistry-Paraffin Cytokeratin 14 Antibody (LL002)
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Choline kinase
alpha Antibody
NBP1-85630
Western Blot Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Applications: EnzAct
Cytokeratin 12
Antibody (2M1K10)
NBP3-33197
Immunohistochemistry Cytokeratin 12 Antibody (2M1K10)
Western Blot Cytokeratin 12 Antibody (2M1K10)
Immunohistochemistry Cytokeratin 12 Antibody (2M1K10)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MUC5AC Antibody
(45M1)
NBP2-15196
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
(5 Reviews)
(28 Publications)
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(849 Publications)
Species: Hu
Applications: BA
Cytokeratin 13
Antibody
NBP2-38166
Western Blot Cytokeratin 13 Antibody
Immunohistochemistry-Paraffin Cytokeratin 13 Antibody
Immunohistochemistry-Paraffin Cytokeratin 13 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
Cytokeratin 3 GST (N- ...
H00003850-Q01
Recombinant Human Cytokeratin 3 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Cytokeratin 3 Recombinant Protein (H00003850-Q01) (0)

There are no publications for Cytokeratin 3 Recombinant Protein (H00003850-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 3 Recombinant Protein (H00003850-Q01) (0)

There are no reviews for Cytokeratin 3 Recombinant Protein (H00003850-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 3 Recombinant Protein (H00003850-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytokeratin 3 Products

Research Areas for Cytokeratin 3 Recombinant Protein (H00003850-Q01)

Find related products by research area.

Blogs on Cytokeratin 3

There are no specific blogs for Cytokeratin 3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytokeratin 3 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol KRT3