Novus Biologicals products are now on bio-techne.com

Cytohesin 2 Recombinant Protein Antigen

Images

 
There are currently no images for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Cytohesin 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cytohesin 2.

Source: E. coli

Amino Acid Sequence: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYTH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68764.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cytohesin 2 Recombinant Protein Antigen

  • ARF exchange factor
  • ARF nucleotide-binding site opener
  • ARNO
  • ARNOPH, SEC7 and coiled-coil domain-containing protein 2
  • CTS18.1
  • CYTH2
  • Cytohesin 2
  • pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)
  • Protein ARNO
  • PSCD2
  • PSCD2L
  • PSCD2LCTS18
  • PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2
  • Sec7 and coiled/coil domains 2 (cytohesin-2)

Background

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with ARF1, ARF3, and ARF6. PSCD2 protein is 83% homologous to PSCD1. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22513
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF6260
Species: Hu
Applications: WB
NBP3-13291
Species: Mu, Rt
Applications: WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00009265-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-34078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-83010
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP) (0)

There are no publications for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP) (0)

There are no reviews for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytohesin 2 Products

Research Areas for Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP)

Find related products by research area.

Blogs on Cytohesin 2

There are no specific blogs for Cytohesin 2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cytohesin 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYTH2