![Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Western-Blot-NBP1-85366-img0004.jpg "Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLIL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP2E1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome P450 2E1 Antibody (NBP1-85366)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP2E1 |
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human liver shows strong cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0012.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human liver shows strong cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85366 (A) shows similar protein distribution across tissues to independent antibody NBP1-85367 (B).](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0008.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85366 (A) shows similar protein distribution across tissues to independent antibody NBP1-85367 (B).")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0009.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human tonsil shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0010.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human tonsil shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0011.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human liver cancer, hepatocellular carcinoma shows moderate cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85366-img0013.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85366] - Staining of human liver cancer, hepatocellular carcinoma shows moderate cytoplasmic positivity in tumor cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")