![Western Blot: Cyclin T2 Antibody [NBP1-87592] - Cyclin T1 (Ccnt1) gene is required for ER stress-mediated CHOP induction and vascular calcification. Immunoblot analysis of CDK9, cyclin T1, cyclin T2, cyclin K, ATF4, CHOP, and GAPDH proteins in BSA (Veh) or 500 um C18:0 treated scrambled (Scramb.) sg or Ccnt1 KO VSMCs for 6 h. Image collected and cropped by CiteAb from the following publication (//www.jbc.org/lookup/doi/10.1074/jbc.RA118.004706), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cyclin-T2-Antibody-Western-Blot-NBP1-87592-img0007.jpg "Western Blot: Cyclin T2 Antibody [NBP1-87592] - Cyclin T1 (Ccnt1) gene is required for ER stress-mediated CHOP induction and vascular calcification. Immunoblot analysis of CDK9, cyclin T1, cyclin T2, cyclin K, ATF4, CHOP, and GAPDH proteins in BSA (Veh) or 500 um C18:0 treated scrambled (Scramb.) sg or Ccnt1 KO VSMCs for 6 h. Image collected and cropped by CiteAb from the following publication (//www.jbc.org/lookup/doi/10.1074/jbc.RA118.004706), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCNT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human and Mouse | 12/02/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin T2 Antibody (NBP1-87592)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 12/02/2016 |
||
| Application: | WB | |
| Species: | Human and Mouse |
| Gene Symbol | CCNT2 |
![Immunocytochemistry/Immunofluorescence: Cyclin T2 Antibody [NBP1-87592] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.](http://images.novusbio.com/fullsize/Cyclin-T2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87592-img0004.jpg "Immunocytochemistry/Immunofluorescence: Cyclin T2 Antibody [NBP1-87592] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: Cyclin T2 Antibody [NBP1-87592] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Cyclin-T2-Antibody-Immunohistochemistry-Paraffin-NBP1-87592-img0005.jpg "Immunohistochemistry-Paraffin: Cyclin T2 Antibody [NBP1-87592] - Staining of human duodenum shows strong nuclear positivity in glandular cells.")
![Knockout Validated: Cyclin T2 Antibody [NBP1-87592] - Cyclin T2 (Ccnt2) and cyclin K (Ccnk) deficiency induces CHOP expression and calcification, opposite of cyclin T1 deficiency. Immunoblot analysis of CDK9, cyclin T1, cyclin T2, cyclin K, ATF4, CHOP, and GAPDH proteins in BSA (Veh) or 500 um C18:0 treated scrambled (Scramb.) sg or Ccnt2 KO VSMCs for 6 h. Image collected and cropped by CiteAb from the following publication (//www.jbc.org/lookup/doi/10.1074/jbc.RA118.004706), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cyclin-T2-Antibody-Knockout-Validated-NBP1-87592-img0006.jpg "Knockout Validated: Cyclin T2 Antibody [NBP1-87592] - Cyclin T2 (Ccnt2) and cyclin K (Ccnk) deficiency induces CHOP expression and calcification, opposite of cyclin T1 deficiency. Immunoblot analysis of CDK9, cyclin T1, cyclin T2, cyclin K, ATF4, CHOP, and GAPDH proteins in BSA (Veh) or 500 um C18:0 treated scrambled (Scramb.) sg or Ccnt2 KO VSMCs for 6 h. Image collected and cropped by CiteAb from the following publication (//www.jbc.org/lookup/doi/10.1074/jbc.RA118.004706), licensed under a CC-BY license.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
