Home » CRCP » CRCP Proteins » CRCP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CRCP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CRCP Protein (NBP1-84495PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CRCP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRCP.

Source: E. coli

Amino Acid Sequence: TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRCP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84495.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRCP Recombinant Protein Antigen

  • Calcitonin gene-related peptide-receptor component protein
  • CGRP receptor component
  • CGRPRCP
  • CGRP-RCPRNA polymerase III subunit C9
  • CGRP-receptor component protein
  • DNA-directed RNA polymerase III subunit RPC9
  • hsC17
  • RCP9
  • RCPMGC111194

Background

CRCP, also known as DNA-directed RNA polymerase III subunit RPC9, is a 17 kDa 148 amino acid protein with three shorter isoforms. The primary function of CRCP is to encode a protein which plays a role in increasing intracellular cAMP levels. CRCP is currently being studied in relation to cystic fibrosis, cryptorchidism, fibrosis, pancreatic cancer and pancreatitis. CRCP has been linked to the cellular localization, acrosome reaction, vasodilation, pathogenesis and parturition pathways where it interacts with POLD3, CHRAC1, VAV2, CALCRL and POLR3H.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CRLR Antibody -
BSA Free
NLS6731
Immunohistochemistry-Paraffin CRLR Antibody - BSA Free
Immunohistochemistry-Paraffin CRLR Antibody - BSA Free
Immunohistochemistry-Paraffin CRLR Antibody - BSA Free
(1 Publication)
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
RAMP1 Antibody
[Unconjugated]
AF6428
Immunohistochemistry RAMP1 Antibody [Unconjugated]
Western Blot RAMP1 Antibody [Unconjugated]
Immunohistochemistry RAMP1 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
FIP1/RCP Antibody
(1A12B9D8) - BSA Free
NBP2-52546
ELISA FIP1/RCP Antibody (1A12B9D8) - BSA Free
Western Blot FIP1/RCP Antibody (1A12B9D8) - BSA Free
Flow Cytometry FIP1/RCP Antibody (1A12B9D8) - BSA Free
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Rab11A Antibody
NBP2-49320
Western Blot Rab11A Antibody
Immunohistochemistry-Paraffin Rab11A Antibody
Immunohistochemistry-Paraffin Rab11A Antibody
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Carboxypeptidase
B1/CPB1 Antibody
NBP2-15698
Western Blot Carboxypeptidase B1/CPB1 Antibody
Western Blot Carboxypeptidase B1/CPB1 Antibody
Western Blot Carboxypeptidase B1/CPB1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Urocortin 3
Antibody
NB100-93444
Western Blot Urocortin 3 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
Recombinant Human
RAG1AP1 GST (N-Term) ...
H00055974-P01
Other Recombinant Human RAG1AP1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Opsin 1 (Medium
Wave) Antibody
NB110-74730
Immunohistochemistry Opsin 1 (Medium Wave) Antibody
Immunohistochemistry-Paraffin Opsin 1 (Medium Wave) Antibody
Immunohistochemistry-Paraffin Opsin 1 (Medium Wave) Antibody
(3 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RAB11FIP5 Antibody
NBP1-81855
Immunocytochemistry/ Immunofluorescence RAB11FIP5 Antibody
Immunohistochemistry-Paraffin RAB11FIP5 Antibody
Immunohistochemistry-Paraffin RAB11FIP5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
DCLK3 Antibody -
BSA Free
NBP1-77129
Immunocytochemistry/ Immunofluorescence DCLK3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DCLK3 Antibody - BSA Free
Immunohistochemistry-Paraffin DCLK3 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
GOLGB1/Giantin
Antibody
NBP2-22321
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
(2 Reviews)
(6 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
RAMP2 Antibody
(773816) [Unconjugate
MAB6500
Flow Cytometry RAMP2 Antibody (773816) [Unconjugated]
Immunohistochemistry RAMP2 Antibody (773816) [Unconjugated]
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, IHC
CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NDUFAB1 Antibody
NBP2-33710
Immunohistochemistry-Paraffin NDUFAB1 Antibody
Immunocytochemistry/ Immunofluorescence NDUFAB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CRCP Recombinant
Protein Antigen
NBP1-84495PEP
CRCP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CRCP Protein (NBP1-84495PEP) (0)

There are no publications for CRCP Protein (NBP1-84495PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRCP Protein (NBP1-84495PEP) (0)

There are no reviews for CRCP Protein (NBP1-84495PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRCP Protein (NBP1-84495PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRCP Products

Research Areas for CRCP Protein (NBP1-84495PEP)

Find related products by research area.

Blogs on CRCP

There are no specific blogs for CRCP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRCP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CRCP