Coronin-1a Antibody

Images

 
Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen ...read more
Western Blot: Coronin-1a Antibody [NBP3-38604] - Western blot analysis of various lysates using Coronin-1a Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Coronin-1a Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human Coronin-1a (NP_001180262.1).

Sequence:
DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CORO1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Coronin-1a Antibody

  • CLIPINA
  • clipin-A
  • CORO1
  • coronin, actin binding protein, 1A
  • coronin, actin-binding protein, 1A
  • coronin-1
  • coronin-1A
  • Coronin-like protein A
  • Coronin-like protein p57
  • FLJ41407
  • HCORO1
  • MGC117380
  • p57
  • TACOCLABP
  • Tryptophan aspartate-containing coat protein

Background

Coronin was originally discovered in Dictyostelium, where it was found to be involved in the chemotactic response of these ameboid cells. The name derives from the fact that the protein is localized at the leading edge or crown of these highly motile cells. The name derives from Corona, which is latin for crown. Coronin homologues have been found in yeast, C. elegans, Drosophila and many other species, and a family them are known in mammals. All coronins belong to the WD40 or WD family of proteins, the prototype or which is the beta subunit of trimeric G-proteins. Coronins appear to be particularly involved in binding to actin, actin associated proteins, tubulin and phospholipase C and have been implicated in the mechanisms of chemotaxis and phagocytosis. In mammals there are at least five major coronin proteins, named coronins 1 to 5 in one nomenclature. Another nomenclature divides these five proteins in coronins 1a and 1b, 2a, 2b and 2c. The mammalian coronin family members are abundant components of eukaryotic cells, and each type has a restricted cell type specific expression pattern. Coronin 1A is the mammalian coronin most similar in protein sequence to the Dictyostelium protein and is found exclusively in hematopoetic lineage cells such as lymphocytes, macrophages and neutrophils. NB 110-58867 is therefore an excellent marker of cells of this lineage and can also be used to study the leading edges particularly of neutrophils. Since the only hematopoetic cells found within the central nervous system are microglia, this antibody is also an excellent marker of this important cell type. Microglia are numerically fairly minor components of the nervous system, but microglial activation is seen in response to a wide variety of damage and disease states, including ALS, Alzheimer's disease and responses to brain tumors. Since coronin 1a is a constitutive component of microglia, the coronin 1a antibody can be used to study both quiescent and activated microglia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47560
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC
NBP1-81351
Species: Hu
Applications: IHC, IHC-P, WB
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for Coronin-1a Antibody (NBP3-38604) (0)

There are no publications for Coronin-1a Antibody (NBP3-38604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coronin-1a Antibody (NBP3-38604) (0)

There are no reviews for Coronin-1a Antibody (NBP3-38604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coronin-1a Antibody (NBP3-38604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Coronin-1a Products

Research Areas for Coronin-1a Antibody (NBP3-38604)

Find related products by research area.

Blogs on Coronin-1a

There are no specific blogs for Coronin-1a, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coronin-1a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CORO1A