Orthogonal Strategies: Analysis in human heart muscle and testis tissues using NBP2-13856 antibody. Corresponding COL8A1 RNA-seq data are presented for the same tissues.
Staining of human heart muscle shows strong cytoplasmic positivity in endothelial cells and smooth muscles.
Staining of human colon shows strong cytoplasmic positivity in endothelial cells.
Staining of human cerebral cortex shows moderate cytoplasmic positivity in endothelial cells.
Staining of human testis shows strong cytoplasmic positivity in peritubular myoid cells.
This antibody was developed against a recombinant protein corresponding to the amino acids: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL8A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Collagen VIII alpha 1 Antibody
alpha-1 polypeptide
chromosome 3 open reading frame 7
collagen, type VIII, alpha 1
smooth muscle cell-expressed and macrophage conditioned medium-induced proteinsmag-64
Background
The Collagen VIII alpha 1 gene encodes one of the two alpha chains of type VIII collagen. The gene product is a short chain collagen and amajor component of the basement membrane of the corneal endothelium. The type VIII collagen fibril can be either ahomo- or a heterotrimer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)
There are no reviews for Collagen VIII alpha 1 Antibody (NBP2-13856).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Collagen VIII alpha 1 Antibody and receive a gift card or discount.