Home » Citidine Deaminase » Citidine Deaminase Proteins » Citidine Deaminase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Citidine Deaminase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Citidine Deaminase Protein (NBP2-39019PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Citidine Deaminase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDA.

Source: E. coli

Amino Acid Sequence: GICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39019.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Citidine Deaminase Recombinant Protein Antigen

  • CDA
  • CDD
  • CDDCytidine aminohydrolase
  • Citidine Deaminase
  • cytidine deaminase
  • cytosine nucleoside deaminase
  • EC 3.5.4.5
  • small cytidine deaminase

Background

CDA encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AICDA Antibody
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody
Immunohistochemistry-Paraffin AICDA Antibody
Western Blot AICDA Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
APOBEC3G Antibody
NBP1-88592
Immunohistochemistry-Paraffin APOBEC3G Antibody
Immunohistochemistry-Paraffin APOBEC3G Antibody
Immunohistochemistry-Paraffin APOBEC3G Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
APOBEC1 Antibody
NBP1-06977
Western Blot APOBEC1 Antibody
(1 Publication)
Species: Mu
Applications: PEP-ELISA, WB
DCK Antibody
(10412)
NBP2-43639
Western Blot DCK Antibody (10412)
Immunocytochemistry/ Immunofluorescence DCK Antibody (10412)
Western Blot DCK Antibody (10412)
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
APOBEC3F Antibody
- Azide and BSA Free
NBP2-92770
Immunohistochemistry-Paraffin APOBEC3F Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin APOBEC3F Antibody - Azide and BSA Free
Western Blot APOBEC3F Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Apolipoprotein
B/ApoB Antibody (3697 ...
MAB4124
Immunohistochemistry Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
(7 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
UNG Antibody
NB600-1031
Western Blot UNG Antibody
Immunohistochemistry-Paraffin UNG Antibody
(5 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ENT1 Antibody
NBP1-84838
Immunohistochemistry-Paraffin ENT1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CD40 Ligand/TNFSF5
[HRP]
DCDL40
N/A CD40 Ligand/TNFSF5 [HRP]
N/A CD40 Ligand/TNFSF5 [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
SCARA3 Antibody
NBP2-13286
Western Blot SCARA3 Antibody
Western Blot SCARA3 Antibody
Immunohistochemistry-Paraffin SCARA3 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Deoxycytidylate
deaminase Antibody (4 ...
H00001635-M01
Western Blot Deoxycytidylate deaminase Antibody (4B9)
Immunohistochemistry-Paraffin Deoxycytidylate deaminase Antibody (4B9)
Western Blot Deoxycytidylate deaminase Antibody (4B9)
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ACF Antibody
NBP1-90271
Western Blot ACF Antibody
Immunohistochemistry-Paraffin ACF Antibody
Immunohistochemistry-Paraffin ACF Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PD-ECGF/Thymidine
Phosphorylase Antibod ...
NB100-2737
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Citidine Deaminase Protein (NBP2-39019PEP) (0)

There are no publications for Citidine Deaminase Protein (NBP2-39019PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Citidine Deaminase Protein (NBP2-39019PEP) (0)

There are no reviews for Citidine Deaminase Protein (NBP2-39019PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Citidine Deaminase Protein (NBP2-39019PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Citidine Deaminase Products

Research Areas for Citidine Deaminase Protein (NBP2-39019PEP)

Find related products by research area.

Blogs on Citidine Deaminase

There are no specific blogs for Citidine Deaminase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Citidine Deaminase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDA