![Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Western-Blot-H00004435-M03-img0007.jpg "Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Flow, ICC/IF, IHC |
| Clone | 5H6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CITED1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | FACS usage reported in scientific literature (PMID: 24349133). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 10/31/2016 |
Summary
Comments
|
||||||||
-(01-mg)_H00004435-M03_11421.jpg)
Enlarge |
reviewed by:
Stefano Da Sacco |
IF | Human | 10/23/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 10/31/2016 |
||
| Application: | IHC-P | |
| Species: | Human |
| Stefano Da Sacco 10/23/2014 |
||
| Application: | IF | |
| Species: | Human |
![Immunocytochemistry/Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - analysis of CITED1 expression in human embryonic kidney cells using anti-CITED1 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Immunocytochemistry-Immunofluorescence-H00004435-M03-img0004.jpg "Immunocytochemistry/Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - analysis of CITED1 expression in human embryonic kidney cells using anti-CITED1 antibody. Image from verified customer review.")
![Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Immunohistochemistry-H00004435-M03-img0010.jpg "Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893/) licensed under a CC-BY license.")
![Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in A-431 (Cat # L015V1).](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Western-Blot-H00004435-M03-img0006.jpg "Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in A-431 (Cat # L015V1).")
![Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Immunohistochemistry-Paraffin-H00004435-M03-img0005.jpg "Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml")
![Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 on paraffin embedded human fetal renal tissue. Image from verified customer review.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Immunohistochemistry-Paraffin-H00004435-M03-img0008.jpg "Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 on paraffin embedded human fetal renal tissue. Image from verified customer review.")
![Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 um.Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-Immunohistochemistry-H00004435-M03-img0009.jpg "Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 um.Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893/) licensed under a CC-BY license.")
![ELISA: CITED1 Antibody (5H6) [H00004435-M03] - Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CITED1-Antibody-5H6-ELISA-H00004435-M03-img0003.jpg "ELISA: CITED1 Antibody (5H6) [H00004435-M03] - Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004435-m03_mouse-monoclonal-cited1-antibody-5h6-310202415485111.jpg "Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004435-m03_mouse-monoclonal-cited1-antibody-5h6-310202415482258.jpg "Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004435-m03_mouse-monoclonal-cited1-antibody-5h6-310202415485125.jpg "Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Western Blot Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Western_Blot_21471.jpg)
![Immunohistochemistry Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-3_AF1197_Immunohistochemistry_7115.jpg)
![Simple Western Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Simple_Western_18971.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
-(01-mg)_H00004435-M03_11421.jpg)