![Western Blot: CDC2L5 Antibody (3G1) [H00008621-M02] - Analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1.Lane 1: CDC2L5 transfected lysate(37 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CDC2L5-Antibody-3G1-Western-Blot-H00008621-M02-img0004.jpg "Western Blot: CDC2L5 Antibody (3G1) [H00008621-M02] - Analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1.Lane 1: CDC2L5 transfected lysate(37 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ELISA |
| Clone | 3G1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDC2L5 (AAH01274, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK |
| Specificity | CDC2L5 - cell division cycle 2-like 5 (cholinesterase-related cell division controller) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CDK13 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. See Simple Western Antibody Database for Simple Western validation: antibody dilution of 1:50; separated by size; detects a band at 130 kDa |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDC2L5 Antibody (H00008621-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: CDC2L5 Antibody (3G1) [H00008621-M02] - Detection limit for recombinant GST tagged CDC2L5 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CDC2L5-Antibody-3G1-Sandwich-ELISA-H00008621-M02-img0003.jpg "Sandwich ELISA: CDC2L5 Antibody (3G1) [H00008621-M02] - Detection limit for recombinant GST tagged CDC2L5 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Jagged 2 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Jagged 2 [Unconjugated]")
