![Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Analysis in human kidney and skeletal muscle tissues using NBP2-47515 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunohistochemistry-Paraffin-NBP2-47515-img0013.jpg "Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Analysis in human kidney and skeletal muscle tissues using NBP2-47515 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC3A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD98 Antibody (NBP2-47515)Find related products by research area.
|
|
CD98 - cell surface glycoprotein that promotes cell adhesion, growth, and survival CD98 is a heterodimeric glycoprotein that contains an 80 kDa heavy chain and a 40 kDa light chain. The CD98 heavy chain is also known as the 4F2 antigen heavy chain or FRP-1, and it is encoded by the SLC3A2 gene. The CD98 heavy chain is capable of... Read full blog post. |
|
xCT: Friend or Foe? There are two opposing sides to the controversial cysteine/glutamate antiporter. On one hand, it can be viewed a guardian of the cell, protecting it from the damaging oxidative stress that can cause cell death and even cancer. But, conversely, it has ... Read full blog post. |
|
Glutathione and xCT: Chemoresistance in Tumor Cells Glutathione, called GSH in its reduced form and GSSG or L(-)-Glutathione in its oxidized form, is an endogenous antioxidant found in most cells in the body. Glutathione's functions include detoxifying xenobiotics from the body, assisting in membrane t... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC3A2 |
![Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.](http://images.novusbio.com/fullsize/CD98-Antibody-Western-Blot-NBP2-47515-img0012.jpg "Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.")
![Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47515-img0010.jpg "Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.")
![Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunohistochemistry-Paraffin-NBP2-47515-img0017.jpg "Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunohistochemistry-Paraffin-NBP2-47515-img0014.jpg "Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunohistochemistry-Paraffin-NBP2-47515-img0015.jpg "Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CD98-Antibody-Immunohistochemistry-Paraffin-NBP2-47515-img0016.jpg "Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_17077.jpg)
![Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Immunocytochemistry__Immunofluorescence_17398.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_23861.jpg)
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![sFRP-1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "sFRP-1 [Unconjugated]")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")