Immunogen | CD8 Antibody was developed against a recombinant protein corresponding to amino acids: AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CD8A |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD8 Antibody (NBP2-34039)Find related products by research area.
|
Is Monkeypox Still A Threat? By Jamshed Arslan, Pharm D, PhD Monkeypox is not deadly like its cousin, smallpox, nor is it as contagious as COVID-19. Yet, it continues to scare the world. In May 2022, a multinational outbreak of a cont... Read full blog post. |
Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ... Read full blog post. |
Synthetic Biotic Medicine as Immunotherapy Against Cancer: Evidence From Arginine-Producing Engineered Bacteria By Jamshed Arslan, Pharm D, PhDWhat do nuts, dairy and red meat have in common? In addition to the fact that they are all edible, one of the answers is L-arginine. This amino acid improves T cell’s respons... Read full blog post. |
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ... Read full blog post. |
Early T cell response is associated with mild COVID-19 and rapid SARS-CoV-2 clearance Jamshed Arslan, Pharm D, PhD SARS-CoV-2 induces both humoral and cellular immunity. A vaccine or natural infection invokes SARS-CoV-2-specific humoral components (antibodies from activated B cells) and cellular resp... Read full blog post. |
Read full blog post. |
Success of combined IL-10 and IL-12 therapy in colon cancer depends on IFN-gamma and gut barrier integrity By Jamshed Arslan, Pharm. D., PhD. Colon cancer is responsible for over 600,000 deaths per year worldwide. Colon cancer can be classified into two categories: mismatch repair (MMR)-deficient and MMR-proficient cancers... Read full blog post. |
mTOR Signaling and the Tumor Microenvironment By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein ... Read full blog post. |
The role of MHC Class II RT1B and immune response post brain injury The major histocompatibility complex (MHC) is responsible for binding peptide fragments arising from pathogens in order to display them on the cell surface for recognition from immune cells. Once recognized, the foreign pathogen is typically evade... Read full blog post. |
Topics in CD11b: The innate immune response Integrins are transmembrane receptors composed of alpha and beta chains, where beta-integrins are mainly expressed in leukocytes. Leukocytes are white blood cells that act in the immune system to defend our body against foreign pathogens. Integrin... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.