Home » CD300f/LMIR3/CD300LF » CD300f/LMIR3/CD300LF Proteins » CD300f/LMIR3/CD300LF Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD300f/LMIR3/CD300LF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD300f/LMIR3/CD300LF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300LF.

Source: E. coli

Amino Acid Sequence: SIVTQITGPTTVNGLERGSLTVQCVYRSGWEAYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPASTTASTPAPTTPTSTTFTAPITQEETSSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD300LF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14463.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD300f/LMIR3/CD300LF Recombinant Protein Antigen

  • CMRF35-like molecule 1
  • CD300 molecule-like family member f
  • CD300f
  • CD300LF
  • CLIM1
  • CLM1
  • CLM-1
  • DIgR2
  • IGSF13
  • IREM1
  • IREM-1
  • LMIR3
  • NKIR
  • Pigr3

Background

CD300LF is an inhibitory receptor of the Ig superfamily expressed on myeloid cells. It mediates negative regulatorysignals by recruiting SHP1 (PTPN6; MIM 176883) or SHIP (INPP5D; MIM 601582) (Sui et al., 2004 (PubMed 15184070);Alvarez-Errico et al., 2004 (PubMed 15549731)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot SHP-1 Antibody (SR41-02)
Flow Cytometry SHP-1 Antibody (SR41-02)
Immunocytochemistry/ Immunofluorescence SHP-1 Antibody (SR41-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TRIF/TICAM1
Antibody - BSA Free
NB120-13810
Knockdown Validated TRIF/TICAM1 Antibody - BSA Free
Unknown TRIF/TICAM1 Antibody - BSA Free
Immunohistochemistry-Paraffin TRIF/TICAM1 Antibody - BSA Free
(37 Publications)
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
CD300c Antibody
[Unconjugated]
AF3256
CD300c Antibody [Unconjugated]
Species: Hu
Applications: WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(183 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
BAFF/BLyS/TNFSF13B
[HRP]
DBLYS0B
N/A BAFF/BLyS/TNFSF13B [HRP]
N/A BAFF/BLyS/TNFSF13B [HRP]
(67 Publications)
Species: Hu
Applications: ELISA
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(87 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(99 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
RNF36 Antibody
NB100-1207
Immunohistochemistry-Paraffin RNF36 Antibody
Immunohistochemistry-Paraffin RNF36 Antibody
Western Blot RNF36 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(155 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
KIR3DL1 Antibody
(DX9) [Unconjugated]
MAB1225
KIR3DL1 Antibody (DX9) [Unconjugated]
(5 Publications)
Species: Hu
Applications: Block, CyTOF-reported, Flow
NKG2A/CD159a/KLRC1
Antibody (131411) [Un ...
MAB1059
Flow Cytometry NKG2A/CD159a/KLRC1 Antibody (131411) [Unconjugated]
Flow Cytometry NKG2A/CD159a/KLRC1 Antibody (131411) [Unconjugated]
(17 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

CD300f/LMIR3/CD300LF R ...
NBP2-14463PEP
CD300f/LMIR3/CD300LF Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP) (0)

There are no publications for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP) (0)

There are no reviews for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD300f/LMIR3/CD300LF Products

Blogs on CD300f/LMIR3/CD300LF

There are no specific blogs for CD300f/LMIR3/CD300LF, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
CXCL8/IL-8 Antibody (6217) [Unconjugated]
MAB208-100
Immunohistochemistry-Paraffin: TLR9 Antibody (26C593.2) [NBP2-24729] - Monkey retina tissue. Image from verified customer review.
TLR9 Antibody (26C593.2) - BSA Free
NBP2-24729
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD300f/LMIR3/CD300LF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD300LF