Novus Biologicals products are now on bio-techne.com

CCR7 Recombinant Protein Antigen

Images

 
There are currently no images for CCR7 Recombinant Protein Antigen (NBP2-57375PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

CCR7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCR7.

Source: E. coli

Amino Acid Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCR7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57375.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCR7 Recombinant Protein Antigen

  • BLR2
  • BLR2C-C chemokine receptor type 7
  • C-C CKR-7
  • CC-CKR-7
  • CCR7
  • CCR-7
  • CD197 antigen
  • CD197
  • CDw197
  • CDw197CC chemokine receptor 7
  • chemokine (C-C motif) receptor 7
  • CMKBR7
  • CMKBR7chemokine (C-C) receptor 7
  • EBI1
  • EBI1EBV-induced G protein-coupled receptor 1
  • EBV-induced G-protein coupled receptor 1
  • Epstein-Barr virus induced gene 1
  • Epstein-Barr virus induced G-protein coupled receptor
  • Epstein-Barr virus-induced G-protein coupled receptor 1
  • EVI1
  • lymphocyte-specific G protein-coupled peptide receptor
  • MIP-3 beta receptor

Background

Chemokine receptor 7 (CCR7) is a G-protein coupled receptor (GPCR) that binds chemokine ligand 19 (CCL19) and chemokine ligand 21 (CCL21) and, together, this receptor-ligand interaction functions in inflammatory and adaptive immune response (1,2). The CCR7 protein contains 7-transmembrane spanning alpha helices and is 378 amino acids (aa) in length, with a theoretical molecular weight of 42.8 kDa (3,4). CCR7 is expressed on several cells within the immune system, including naive T cells, central memory T cells, regulatory T cells, naive B cells, a subset of double negative and single positive thymocytes, and mature dendritic cells (DCs) (1, 3).

The primary role of the CCR7/CCL19/CCL21 chemokine signaling axis is homing T cells and DCs to lymph nodes and lymphoid tissues to initiate an immune response (1,2,5,6). In the context of cancer, the CCR7 signaling axis appears to have two opposing roles (2). Downregulation of CCR7 on CD8+ T cells contributes to effector cell migration and anti-cancer activities via cytotoxic tumor-infiltrating lymphocytes (2). However, upregulation of CCR7 by cancer cells can result in cancer cell migration and metastasis (2). Overexpression of CCR7 has been implicated in a variety of cancers including breast, cervical, gastric, head and neck cell carcinoma, and prostate (1,2,7). Studies in breast cancer have found that hypoxia increases CCR7 expression, and this activation can affect cancer cell invasion, extravasation, proliferation, angiogenesis, and metastasis through induction of multiple signaling transduction pathways such as PI3K/AKT, MAPK, and JAK/STAT (5,7).

Given its important role in inflammation and immune response, several strategies have been employed to target the CCR7 signaling axis for cancer immunotherapy (2). Some cancer immunotherapies under investigation include intra-tumoral administration of CCL19 and CCL21, introduction of patient-derived cells transfected to express CCR7 or its ligands, and vaccines (2). Further interrogation of CCR7/CCL19/CCL21 signaling axis is required to develop better therapeutic strategies for cancer treatment.

References:

1. Comerford, I., Harata-Lee, Y., Bunting, M. D., Gregor, C., Kara, E. E., & McColl, S. R. (2013). A myriad of functions and complex regulation of the CCR7/CCL19/CCL21 chemokine axis in the adaptive immune system. Cytokine & growth factor reviews, 24(3), 269-283. https://doi.org/10.1016/j.cytogfr.2013.03.001

2. Salem, A., Alotaibi, M., Mroueh, R., Basheer, H. A., & Afarinkia, K. (2021). CCR7 as a therapeutic target in Cancer. Biochimica et biophysica acta. Reviews on cancer, 1875(1), 188499. https://doi.org/10.1016/j.bbcan.2020.188499

3. Yan, Y., Chen, R., Wang, X., Hu, K., Huang, L., Lu, M., & Hu, Q. (2019). CCL19 and CCR7 Expression, Signaling Pathways, and Adjuvant Functions in Viral Infection and Prevention. Frontiers in cell and developmental biology, 7, 212. https://doi.org/10.3389/fcell.2019.00212

4. Uniprot (P32248)

5. Korbecki, J., Grochans, S., Gutowska, I., Barczak, K., & Baranowska-Bosiacka, I. (2020). CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of Receptors CCR5, CCR6, CCR7, CCR8, CCR9, and CCR10 Ligands. International journal of molecular sciences, 21(20), 7619. https://doi.org/10.3390/ijms21207619

6. Sanchez-Sanchez, N., Riol-Blanco, L., & Rodriguez-Fernandez, J. L. (2006). The multiple personalities of the chemokine receptor CCR7 in dendritic cells. Journal of immunology (Baltimore, Md. : 1950), 176(9), 5153-5159. https://doi.org/10.4049/jimmunol.176.9.5153

7. Rizeq, B., & Malki, M. I. (2020). The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers, 12(4), 1036. https://doi.org/10.3390/cancers12041036

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

366-6C
Species: Hu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
361-MI
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
7268-CT
Species: Hu
Applications: BA
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DY417
Species: Mu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-48848
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
202-IL
Species: Hu
Applications: BA
MAB1774
Species: Hu
Applications: CyTOF-ready, Flow, ICC
6507-IL/CF
Species: Hu
Applications: BA
NBP2-57375PEP
Species: Hu
Applications: AC

Publications for CCR7 Recombinant Protein Antigen (NBP2-57375PEP) (0)

There are no publications for CCR7 Recombinant Protein Antigen (NBP2-57375PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCR7 Recombinant Protein Antigen (NBP2-57375PEP) (0)

There are no reviews for CCR7 Recombinant Protein Antigen (NBP2-57375PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCR7 Recombinant Protein Antigen (NBP2-57375PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCR7 Products

Research Areas for CCR7 Recombinant Protein Antigen (NBP2-57375PEP)

Find related products by research area.

Blogs on CCR7

There are no specific blogs for CCR7, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCR7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCR7