Immunogen | This Caspase-3 Antibody was developed against a recombinant Protein corresponding to amino acids: HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CASP3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Theoretical MW | 31.7 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Caspase-3 Antibody (NBP1-90125)Find related products by research area.
|
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
Read full blog post. |
The Ins and Outs of Survivin By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of ... Read full blog post. |
Cleaved Caspase-3: A Marker of Programmed Cell Death What are Caspases?Caspases, or cysteine-dependent aspartate specific proteases, are a family of enzymes crucial for initiating and executing apoptosis within a cell, an important biological event especially during organ development (1). Environme... Read full blog post. |
Caspase-3, The Executioner of Apoptosis The Role of Caspase-3 in ApoptosisCaspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinat... Read full blog post. |
Caspase 7 - A key effector of the apoptotic pathway Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a... Read full blog post. |
Caspase 11 - A proinflammatory caspase that induces the innate immune response While known for their role in programmed cell death, caspases are also essential for mediating inflammatory responses and innate immunity. Binding of microbial molecules by pattern recognition receptors triggers the formation of the multiprotein in... Read full blog post. |
LC3/LC3B - measuring autophagosome formation and autophagic flux Microtubule-associated protein-1 light chain 3 (LC3/LC3B) is a ubiquitin-like protein involved in the formation of the autophagosome. It is homologous to the yeast Atg8 protein. Autophagosomes are important for the degradation and recycling of intr... Read full blog post. |
D4-GDI (GDP dissociation inhibitor, RhoGD12) The D4-GDI protein is a negative regulator of the Ras-related Rho family of small molecule "molecular switch" GTPases. The Rho GTPases modify cell structure and architecture via rapid changes to the actin cytoskeleton and cell membrane. M... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CASP3 |