![Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537] - Analysis in control (vector only transfected HEK293T lysate) and CA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Western-Blot-NBP1-87537-img0005.jpg "Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537] - Analysis in control (vector only transfected HEK293T lysate) and CA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CA6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Carbonic Anhydrase VI Antibody (NBP1-87537)Find related products by research area.
|
|
CHOP/GADD153 - A regulator and marker for ER-stress induced apoptosis C/EBP homologous protein (CHOP) is a transcription factor that regulates apoptosis in response to cellular stress. CHOP also known as growth arrest and DNA damage 153 (GADD153) was first cloned because of its induction in response to genotoxic str... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CA6 |
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0008.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human salivary gland shows strong cytoplasmic and extra cellular positivity in glandular cells.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0001.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human salivary gland shows strong cytoplasmic and extra cellular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0003.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining in human salivary gland and colon tissues using anti-CA6 antibody. Corresponding CA6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0004.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining in human salivary gland and colon tissues using anti-CA6 antibody. Corresponding CA6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon, liver, lymph node and salivary gland using Anti-CA6 antibody NBP1-87537 (A) shows similar protein distribution across tissues to independent antibody NBP1-87536 (B).](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0006.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon, liver, lymph node and salivary gland using Anti-CA6 antibody NBP1-87537 (A) shows similar protein distribution across tissues to independent antibody NBP1-87536 (B).")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human liver.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Immunohistochemistry-Paraffin-NBP1-87537-img0007.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human liver.")
![Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_MAB2186_Western_Blot_11051.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")