Home » Calpain 2 » Calpain 2 Proteins » Calpain 2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Calpain 2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Calpain 2 Protein (NBP1-88204PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Calpain 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAPN2.

Source: E. coli

Amino Acid Sequence: ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88204.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calpain 2 Recombinant Protein Antigen

  • Calcium-activated neutral proteinase 2
  • calpain 2, (m/II) large subunit
  • calpain 2, large [catalytic] subunit
  • calpain 2, large subunit
  • Calpain large polypeptide L2
  • Calpain M-type
  • calpain, large polypeptide L2
  • calpain-2 catalytic subunit
  • Calpain-2 large subunit
  • CANP 2
  • CANPL2CANP2
  • CANPml
  • EC 3.4.22
  • EC 3.4.22.53
  • FLJ39928
  • M-calpain
  • mCANP
  • millimolar-calpain

Background

The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammaliancalpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist ofheterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This geneencodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites inthe 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Calpastatin
Antibody (OTI1E7)
NBP2-01819
Flow Cytometry Calpastatin Antibody (OTI1E7)
Western Blot Calpastatin Antibody (OTI1E7)
Immunohistochemistry-Paraffin Calpastatin Antibody (OTI1E7)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Calpain 1 Antibody
NBP2-15671
Immunoprecipitation Calpain 1 Antibody
Western Blot Calpain 1 Antibody
Immunohistochemistry-Paraffin Calpain 1 Antibody
(1 Publication)
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
Calpain S1
Antibody (3C4)
H00000826-M01
Western Blot Calpain S1 Antibody (3C4)
Immunocytochemistry/ Immunofluorescence Calpain S1 Antibody (3C4)
Immunohistochemistry-Paraffin Calpain S1 Antibody (3C4)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
FAM111B Antibody
NBP1-86645
Immunocytochemistry/ Immunofluorescence FAM111B Antibody
Immunohistochemistry-Paraffin FAM111B Antibody
Immunohistochemistry-Paraffin FAM111B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(387 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Calpain 3 Antibody
NBP1-31756
Immunocytochemistry/ Immunofluorescence Calpain 3 Antibody
Western Blot Calpain 3 Antibody
Species: Hu
Applications: ICC/IF, WB
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Cathepsin B
Antibody [Unconjugate
AF965
Immunohistochemistry Cathepsin B Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]
(1 Review)
(51 Publications)
Species: Mu
Applications: IHC, Neut, WB
Calpain 2 Antibody
NBP1-88204
Immunohistochemistry-Paraffin Calpain 2 Antibody
Immunohistochemistry-Paraffin Calpain 2 Antibody
Immunohistochemistry-Paraffin Calpain 2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Cathepsin D
Antibody [Unconjugate
AF1029
Immunohistochemistry Cathepsin D Antibody [Unconjugated]
Immunocytochemistry Cathepsin D Antibody [Unconjugated]
Western Blot Cathepsin D Antibody [Unconjugated]
(54 Publications)
Species: Mu
Applications: ICC, IHC, IP, WB
Cathepsin L
Antibody [Unconjugate
AF952
Western Blot Cathepsin L Antibody [Unconjugated]
Immunohistochemistry Cathepsin L Antibody [Unconjugated]
Western Blot Cathepsin L Antibody [Unconjugated]
(27 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Caspase-12
Antibody - BSA Free
NBP1-76801
Immunocytochemistry/ Immunofluorescence Caspase-12 Antibody - BSA Free
Western Blot Caspase-12 Antibody - BSA Free
Immunohistochemistry-Paraffin Caspase-12 Antibody - BSA Free
(2 Reviews)
(6 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Calpain 2
Recombinant Protein A
NBP1-88204PEP
Calpain 2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Calpain 2 Protein (NBP1-88204PEP) (0)

There are no publications for Calpain 2 Protein (NBP1-88204PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 2 Protein (NBP1-88204PEP) (0)

There are no reviews for Calpain 2 Protein (NBP1-88204PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calpain 2 Protein (NBP1-88204PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpain 2 Products

Research Areas for Calpain 2 Protein (NBP1-88204PEP)

Find related products by research area.

Blogs on Calpain 2

There are no specific blogs for Calpain 2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calpain 2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CAPN2