C5L2/GPR77 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C5L2/GPR77 (NP_001258678.1). Peptide sequence ALAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSH |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
C5AR2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for C5L2/GPR77 Antibody
Background
Official Gene Symbol: GPR77 Gen Bank Accession Number: NP_060955 Gene ID: 27202 (human) Gene Map Locus: 19q13.33 (human) C5L2 is 337A.A orphan member that belongs to anaphylatoxin receptor family. It is a seven transmembrane G-protein-coupled receptor consisting of an N-terminal N-glycosylation site, several conserved cysteines and several potential C-terminal phosphorylation sites. It binds to C5a and C5a-des-Arg and serves as a highly regulated scavenger receptor with a negative modulatory influence on C5aR-mediated inflammation. Northern Blot analysis suggests it is co- expressed along with C5aR in different tissues and cells including neutrophils/macrophages, mast cells, dendritic cells, brain, lung, heart, kidney, liver, ovary and testis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Publications for C5L2/GPR77 Antibody (NBP3-10864) (0)
There are no publications for C5L2/GPR77 Antibody (NBP3-10864).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for C5L2/GPR77 Antibody (NBP3-10864) (0)
There are no reviews for C5L2/GPR77 Antibody (NBP3-10864).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for C5L2/GPR77 Antibody (NBP3-10864) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional C5L2/GPR77 Products
Blogs on C5L2/GPR77