Home » beta-1,3-Glucuronyltransferase 1/B3GAT1 » beta-1,3-Glucuronyltransferase 1/B3GAT1 Proteins » beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human beta-1,3-Glucuronyltransferase 1/B3GAT1

Source: E.coli

Amino Acid Sequence: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
B3GAT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21368. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen

  • B3GAT1
  • beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P)
  • Beta-1,3-glucuronyltransferase 1
  • CD57
  • EC 2.4.1.135
  • galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
  • GLCATP
  • GlcAT-P
  • GLCATPGLCUATP
  • GLCUATP
  • glcUAT-P
  • Glucuronosyltransferase P
  • HNK1
  • LEU7
  • NK1
  • NK-1
  • UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase

Background

CD57 represents a 100 kDa oligosaccharide antigenic determinant present on a variety of polypeptides, lipids and chondroitan sulfate proteoglycans. It is expressed on 7-35% of normal peripheral blood lymphocytes, including subsets of NK cells and CD8+ T lymphocytes. The function of CD57 is unknown. (1-6)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(45 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Fc gamma RIII
(CD16) Antibody [Unco ...
AF1597
Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: Block, WB
Fc gamma
RIIIA/CD16a [Unconjug
4325-FC
SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]
Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]
SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]
(21 Publications)
Species: Hu
Applications: Bind
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA
CD28 Antibody
(37407) [Unconjugated
MAB342
Agonist Activity CD28 Antibody (37407) [Unconjugated]
Immunocytochemistry CD28 Antibody (37407) [Unconjugated]
(1 Review)
(49 Publications)
Species: Hu
Applications: AgAct, ICC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Neurokinin B
Antibody - BSA Free
NB300-201
Immunohistochemistry Neurokinin B Antibody - BSA Free
Immunohistochemistry Neurokinin B Antibody - BSA Free
Immunohistochemistry Neurokinin B Antibody - BSA Free
(2 Reviews)
(25 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP) (0)

There are no publications for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP) (0)

There are no reviews for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta-1,3-Glucuronyltransferase 1/B3GAT1 Products

Research Areas for beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen (NBP3-21368PEP)

Find related products by research area.

Blogs on beta-1,3-Glucuronyltransferase 1/B3GAT1

There are no specific blogs for beta-1,3-Glucuronyltransferase 1/B3GAT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol B3GAT1