Home » BAMBI/NMA » BAMBI/NMA Proteins » BAMBI/NMA Recombinant Protein Antigen

BAMBI/NMA Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

BAMBI/NMA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAMBI.

Source: E. coli

Amino Acid Sequence: NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAMBI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58990.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BAMBI/NMA Recombinant Protein Antigen

  • BAMBI
  • BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
  • BMP and activin membrane-bound inhibitor homolog
  • NMA
  • NMANon-metastatic gene A protein
  • Putative transmembrane protein NMA

Background

BAMBI encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(141 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(530 Publications)
Species: Hu
Applications: BA, BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
BMP-7
[Unconjugated]
354-BP
Bioactivity BMP-7 [Unconjugated]
Cell Culture BMP-7 [Unconjugated]
(96 Publications)
Species: Hu
Applications: BA
Follistatin [HRP]
DFN00
N/A Follistatin [HRP]
N/A Follistatin [HRP]
N/A Follistatin [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
BMP-2
[Unconjugated]
355-BM
Bioactivity BMP-2 [Unconjugated]
(191 Publications)
Species: Hu, Mu, Rt
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(458 Publications)
Species: Hu
Applications: BA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(600 Publications)
Species: Hu
Applications: BA
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(145 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Gremlin 1 Antibody
[Unconjugated]
AF956
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
(1 Review)
(18 Publications)
Species: Hu, Mu
Applications: Block, IHC
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
MID1 Antibody
NBP1-26612
Western Blot MID1 Antibody
(3 Publications)
Species: Hu
Applications: IP (-), WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
Chordin
[Unconjugated]
758-CN/CF
Chordin [Unconjugated]
(11 Publications)
Species: Mu
Applications: BA

Publications for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP) (0)

There are no publications for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP) (0)

There are no reviews for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAMBI/NMA Recombinant Protein Antigen (NBP2-58990PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAMBI/NMA Products

Blogs on BAMBI/NMA

There are no specific blogs for BAMBI/NMA, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAMBI/NMA Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BAMBI