![Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining in human duodenum and skeletal muscle tissues using anti-BAIAP2L1 antibody. Corresponding BAIAP2L1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Immunohistochemistry-Paraffin-NBP1-89537-img0010.jpg "Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining in human duodenum and skeletal muscle tissues using anti-BAIAP2L1 antibody. Corresponding BAIAP2L1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BAIAP2L1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BAIAP2L1 |
![Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Analysis using Anti-BAIAP2L1 antibody NBP1-89537 (A) shows similar pattern to independent antibody NBP1-89542 (B).](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Western-Blot-NBP1-89537-img0012.jpg "Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Analysis using Anti-BAIAP2L1 antibody NBP1-89537 (A) shows similar pattern to independent antibody NBP1-89542 (B).")
![Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537] - Staining of human cell line U-2 OS shows localization to plasma membrane.](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89537-img0007.jpg "Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537] - Staining of human cell line U-2 OS shows localization to plasma membrane.")
![Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Western-Blot-NBP1-89537-img0006.jpg "Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Analysis in human cell line CAPAN-2.](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Western-Blot-NBP1-89537-img0011.jpg "Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Analysis in human cell line CAPAN-2.")
![Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human duodenum shows high expression.](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Immunohistochemistry-Paraffin-NBP1-89537-img0008.jpg "Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human duodenum shows high expression.")
![Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/BAIAP2L1-Antibody-Immunohistochemistry-Paraffin-NBP1-89537-img0009.jpg "Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")