Home » ATIC » ATIC Proteins » ATIC Recombinant Protein Antigen

ATIC Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATIC Protein (NBP1-89192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

ATIC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATIC.

Source: E. coli

Amino Acid Sequence: ANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATIC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89192.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATIC Recombinant Protein Antigen

  • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMPcyclohydrolase
  • 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotidetransformylase/inosinicase
  • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
  • AICAR
  • AICARFT
  • AICARFT/IMPCHASE
  • bifunctional purine biosynthesis protein PURH
  • IMPCHASE
  • phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  • PURHFLJ93545

Background

ATIC is a 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase which helps catalyze the penultimate and final steps of the de novo purine biosynthetic pathway. The human ATIC cDNA encodes a deduced 591 amino acid protein that is 81% identical to the chicken sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(43 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot LKB1/STK11 Antibody - BSA Free
Immunohistochemistry-Paraffin LKB1/STK11 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence LKB1/STK11 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
BRAP Antibody
NBP1-91705
Immunocytochemistry/ Immunofluorescence BRAP Antibody
Immunohistochemistry-Paraffin BRAP Antibody
Immunohistochemistry-Paraffin BRAP Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IMPA1 Antibody
NBP1-83107
Western Blot IMPA1 Antibody
Immunocytochemistry/ Immunofluorescence IMPA1 Antibody
Immunohistochemistry-Paraffin IMPA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
TBC1D4 Antibody
(OTI5E6) - Azide and ...
NBP2-74462
Western Blot TBC1D4 Antibody (OTI5E6) - Azide and BSA Free
Flow Cytometry TBC1D4 Antibody (OTI5E6) - Azide and BSA Free
Flow Cytometry TBC1D4 Antibody (OTI5E6) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(187 Publications)
Species: Hu
Applications: ELISA
PYK2/FAK2 Antibody
NBP3-12969
Western Blot PYK2/FAK2 Antibody
Immunocytochemistry/ Immunofluorescence PYK2/FAK2 Antibody
Immunoprecipitation PYK2/FAK2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Adenylosuccinate
Lyase Antibody (OTI2D ...
NBP2-03107
Flow Cytometry Adenylosuccinate Lyase Antibody (OTI2D10)
Western Blot Adenylosuccinate Lyase Antibody (OTI2D10)
Immunohistochemistry-Paraffin Adenylosuccinate Lyase Antibody (OTI2D10)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
ATIC Recombinant
Protein Antigen
NBP1-89192PEP
ATIC Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATIC Protein (NBP1-89192PEP) (0)

There are no publications for ATIC Protein (NBP1-89192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATIC Protein (NBP1-89192PEP) (0)

There are no reviews for ATIC Protein (NBP1-89192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATIC Protein (NBP1-89192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATIC Products

Research Areas for ATIC Protein (NBP1-89192PEP)

Find related products by research area.

Blogs on ATIC

There are no specific blogs for ATIC, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATIC Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATIC