Home » ATF3 » ATF3 Proteins » ATF3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ATF3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATF3 Recombinant Protein Antigen (NBP2-34489PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATF3.

Source: E. coli

Amino Acid Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34489.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATF3 Recombinant Protein Antigen

  • activating transcription factor 3cAMP-dependent transcription factor ATF-3
  • ATF3deltaZip2
  • ATF3deltaZip2c
  • ATF3deltaZip3
  • cyclic AMP-dependent transcription factor ATF-3

Background

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(221 Publications)
Species: Hu
Applications: Bind, BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]
(14 Publications)
Species: Hu
Applications: EnzAct
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(46 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(670 Publications)
Species: Mu
Applications: ELISA
EGR1 Antibody
[Unconjugated]
AF2818
Immunocytochemistry EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
ATF2 [p Thr69]
Antibody
NB100-81798
Western Blot ATF2 [p Thr69] Antibody
Immunohistochemistry-Paraffin ATF2 [p Thr69] Antibody
Western Blot ATF2 [p Thr69] Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATF4 Antibody
NB100-852
Western Blot ATF4 Antibody
Western Blot ATF4 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: PEP-ELISA, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Nrf2 Antibody
NBP1-32822
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
(4 Reviews)
(71 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
GDF-15 [HRP]
DGD150
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
(99 Publications)
Species: Hu
Applications: ELISA
ATF3 Recombinant
Protein Antigen
NBP2-34489PEP
ATF3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATF3 Recombinant Protein Antigen (NBP2-34489PEP) (0)

There are no publications for ATF3 Recombinant Protein Antigen (NBP2-34489PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF3 Recombinant Protein Antigen (NBP2-34489PEP) (0)

There are no reviews for ATF3 Recombinant Protein Antigen (NBP2-34489PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATF3 Recombinant Protein Antigen (NBP2-34489PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATF3 Products

Research Areas for ATF3 Recombinant Protein Antigen (NBP2-34489PEP)

Find related products by research area.

Blogs on ATF3.

Check out the latest blog posts on ATF3.
Chemotherapy-induced metastasis: An unexpected foe?
By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che...  Read full blog post.
Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State
MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
ATF3 Antibody
NBP1-85816

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATF3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATF3