Biological Strategies: Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. ...read more
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was ...read more
Genetic Strategies: Western Blot: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a ...read more
Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase & ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. (a,b) ST88-14 cells were transfected for 24 h ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. A, Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) ...read more
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to ...read more
Western Blot: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy does not induce ATF3 in Schwann cells. A, Cryosections from injured DRG (inset) & distal sciatic nerve from the same mouse processed for ATF3 ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 30993183). Feline reactivity reported from a verified customer review. Rat reactivity reported in (PMID: 30101191), also customer review.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Konopleva M, Yap T, Daver N et al. Targeting Oxidative Phosphorylation with a Mitochondrial Complex I Inhibitor is limited by Mechanism-based Toxicity Research Square (IHC-Fr, Mouse)
Perez-Sanchez J, Middleton S, Pattison L et al. Inhibition of sensory neuron driven acute, inflammatory, and neuropathic pain using a humanised chemogenetic system bioRxiv 2023-03-22
Fixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Chemotherapy-induced metastasis: An unexpected foe? By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA. Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa and beta-actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-35806-5), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ATF3-Antibody-Western-Blot-NBP1-85816-img0027.jpg "Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA. Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa and beta-actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-35806-5), licensed under a CC-BY license.")
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
![Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. Nuclei stained with DAPI (blue). Image from verified customer review.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85816-img0028.jpg "Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. Nuclei stained with DAPI (blue). Image from verified customer review.")
![Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0168-19.2019), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-NBP1-85816-img0025.jpg "Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0168-19.2019), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85816-img0012.jpg "Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-Paraffin-NBP1-85816-img0015.jpg "Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-Paraffin-NBP1-85816-img0016.jpg "Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-Paraffin-NBP1-85816-img0017.jpg "Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.")
![Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-Paraffin-NBP1-85816-img0018.jpg "Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.")
![Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was localized in the nucleus. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/ATF3-Antibody-Immunohistochemistry-Frozen-NBP1-85816-img0023.jpg "Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was localized in the nucleus. Image submitted by a verified customer review.")
![Western Blot: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a positive signal in nuclei of axotomized sensory neurons in ATF3+/+ mice, but not ATF3cre/cre mice. Note that the Santa Cruz antibody (C-19) labels neuronal nuclei in in the latter (inset), indicating non-specific staining. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0025-19.2019), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ATF3-Antibody-Knockout-Validated-NBP1-85816-img0026.jpg "Western Blot: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a positive signal in nuclei of axotomized sensory neurons in ATF3+/+ mice, but not ATF3cre/cre mice. Note that the Santa Cruz antibody (C-19) labels neuronal nuclei in in the latter (inset), indicating non-specific staining. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0025-19.2019), licensed under a CC-BY license.")
![Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase & ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. (a,b) ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA (a) or treated with WP1130 at the concentration of 1.25 & 2.5 µM (b). Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa & beta -actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. (c–e) Ultrastructural appearance of untreated control cells using TEM. (f–h) After treatment with WP1130 at the concentration of 2.5 µM (f,g,h) T265-2c cells showed extensive cytosolic vacuolization (f, red arrows) & swelling of ER (g, red arrowheads) & mitochondria (h, red arrows). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30478285), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85816_rabbit-polyclonal-atf3-antibody-310202415171333.jpg "Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase & ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. (a,b) ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA (a) or treated with WP1130 at the concentration of 1.25 & 2.5 µM (b). Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa & beta -actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. (c–e) Ultrastructural appearance of untreated control cells using TEM. (f–h) After treatment with WP1130 at the concentration of 2.5 µM (f,g,h) T265-2c cells showed extensive cytosolic vacuolization (f, red arrows) & swelling of ER (g, red arrowheads) & mitochondria (h, red arrows). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30478285), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. A, Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a positive signal in nuclei of axotomized sensory neurons in ATF3+/+ mice, but not ATF3cre/cre mice. Note that the Santa Cruz antibody (C-19) labels neuronal nuclei in in the latter (inset), indicating non-specific staining. B, C, Axotomy induced reporter expression in sensory (DRG), sympathetic (stellate ganglion, SG), & motoneurons 4 d after injury. D, Reporter expression in sensory axons & motoneurons one week after injury. E, Preventing CreERT2 translocation from cytoplasm to nucleus with ICI 182780 reduces recombination in ATF3+ cells (by ∼50%). F, Recombination efficiency 16 d after injury was calculated by expressing the proportion of tracer-filled somata (labeled at the time of injury) that were also reporter (tdtomato)-positive. G, Recombination efficiencies at 4 & 16 d after injury (n = 3 for each time point) for DRG & motoneurons. Images in panels A, B, E were taken from whole mounts, those in C, D, F from cryosections. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85816_rabbit-polyclonal-atf3-antibody-31020241613641.jpg "Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. A, Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) produces a positive signal in nuclei of axotomized sensory neurons in ATF3+/+ mice, but not ATF3cre/cre mice. Note that the Santa Cruz antibody (C-19) labels neuronal nuclei in in the latter (inset), indicating non-specific staining. B, C, Axotomy induced reporter expression in sensory (DRG), sympathetic (stellate ganglion, SG), & motoneurons 4 d after injury. D, Reporter expression in sensory axons & motoneurons one week after injury. E, Preventing CreERT2 translocation from cytoplasm to nucleus with ICI 182780 reduces recombination in ATF3+ cells (by ∼50%). F, Recombination efficiency 16 d after injury was calculated by expressing the proportion of tracer-filled somata (labeled at the time of injury) that were also reporter (tdtomato)-positive. G, Recombination efficiencies at 4 & 16 d after injury (n = 3 for each time point) for DRG & motoneurons. Images in panels A, B, E were taken from whole mounts, those in C, D, F from cryosections. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a sciatic nerve transection (SN injury) at 3 d post-injury stained for cJun, Isl1 (all neurons), & IB4. Arrows point to cJun-positive, IB4-negative neurons, & arrowheads point to cJun, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. B, Quantification of percentage of cJun-positive neurons from A. C, Immunohistochemistry of L4 DRG for Atf3, Isl1 (all neurons) & IB4. Arrows point to Atf3-positive, IB4-negative neurons & arrowheads point to Atf3, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. D, Quantification of percentage of Atf3-positive neurons from C. E, Western blotting of uninjured control & Tsc2 cKO L4/L5 DRG from mice receiving daily vehicle or rapamycin treatment for 3 d. F, Quantification of protein expression from E. Log2 fold change relative to uninjured control from the same biological replicate. N.S., not significant, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Extended Data Figure 5-1 shows data values of mean & SEM, number of replicates, statistical tests, & values for all comparisons. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31182472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85816_rabbit-polyclonal-atf3-antibody-31020241613637.jpg "Immunohistochemistry: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a sciatic nerve transection (SN injury) at 3 d post-injury stained for cJun, Isl1 (all neurons), & IB4. Arrows point to cJun-positive, IB4-negative neurons, & arrowheads point to cJun, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. B, Quantification of percentage of cJun-positive neurons from A. C, Immunohistochemistry of L4 DRG for Atf3, Isl1 (all neurons) & IB4. Arrows point to Atf3-positive, IB4-negative neurons & arrowheads point to Atf3, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. D, Quantification of percentage of Atf3-positive neurons from C. E, Western blotting of uninjured control & Tsc2 cKO L4/L5 DRG from mice receiving daily vehicle or rapamycin treatment for 3 d. F, Quantification of protein expression from E. Log2 fold change relative to uninjured control from the same biological replicate. N.S., not significant, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Extended Data Figure 5-1 shows data values of mean & SEM, number of replicates, statistical tests, & values for all comparisons. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31182472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a sciatic nerve transection (SN injury) at 3 d post-injury stained for cJun, Isl1 (all neurons), & IB4. Arrows point to cJun-positive, IB4-negative neurons, & arrowheads point to cJun, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. B, Quantification of percentage of cJun-positive neurons from A. C, Immunohistochemistry of L4 DRG for Atf3, Isl1 (all neurons) & IB4. Arrows point to Atf3-positive, IB4-negative neurons & arrowheads point to Atf3, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. D, Quantification of percentage of Atf3-positive neurons from C. E, Western blotting of uninjured control & Tsc2 cKO L4/L5 DRG from mice receiving daily vehicle or rapamycin treatment for 3 d. F, Quantification of protein expression from E. Log2 fold change relative to uninjured control from the same biological replicate. N.S., not significant, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Extended Data Figure 5-1 shows data values of mean & SEM, number of replicates, statistical tests, & values for all comparisons. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31182472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85816_rabbit-polyclonal-atf3-antibody-31020241612236.jpg "Western Blot: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a sciatic nerve transection (SN injury) at 3 d post-injury stained for cJun, Isl1 (all neurons), & IB4. Arrows point to cJun-positive, IB4-negative neurons, & arrowheads point to cJun, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. B, Quantification of percentage of cJun-positive neurons from A. C, Immunohistochemistry of L4 DRG for Atf3, Isl1 (all neurons) & IB4. Arrows point to Atf3-positive, IB4-negative neurons & arrowheads point to Atf3, IB4 double-positive neurons in uninjured Tsc2 cKO DRG. Scale bars: 50 μm. D, Quantification of percentage of Atf3-positive neurons from C. E, Western blotting of uninjured control & Tsc2 cKO L4/L5 DRG from mice receiving daily vehicle or rapamycin treatment for 3 d. F, Quantification of protein expression from E. Log2 fold change relative to uninjured control from the same biological replicate. N.S., not significant, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Extended Data Figure 5-1 shows data values of mean & SEM, number of replicates, statistical tests, & values for all comparisons. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31182472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy does not induce ATF3 in Schwann cells. A, Cryosections from injured DRG (inset) & distal sciatic nerve from the same mouse processed for ATF3 immunohistochemistry (Novus NBP1-85816). B, Punctate staining in the nerve proved to be non-specific fluorescence of leukocytes (note non-nuclear signal in the absence of primary antibody). C, In intact sciatic nerves, cells morphologically identical to Remak cells had at some point undergone recombination. D, Following injury, their numbers increased. E, This was attributable to their proliferation in the injured nerve (as opposed to ATF3 induction & subsequent recombination). C′, D′, Magnification of areas outlined in C & D demonstrate the spindle shaped morphology characteristic of Remak cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85816_rabbit-polyclonal-atf3-antibody-310202416121992.jpg "Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy does not induce ATF3 in Schwann cells. A, Cryosections from injured DRG (inset) & distal sciatic nerve from the same mouse processed for ATF3 immunohistochemistry (Novus NBP1-85816). B, Punctate staining in the nerve proved to be non-specific fluorescence of leukocytes (note non-nuclear signal in the absence of primary antibody). C, In intact sciatic nerves, cells morphologically identical to Remak cells had at some point undergone recombination. D, Following injury, their numbers increased. E, This was attributable to their proliferation in the injured nerve (as opposed to ATF3 induction & subsequent recombination). C′, D′, Magnification of areas outlined in C & D demonstrate the spindle shaped morphology characteristic of Remak cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0004.jpg)
![Immunohistochemistry-Paraffin ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Immunohistochemistry-NB100-81798-img0003.jpg)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0001.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_108.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_698.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_2661.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
