Biological Strategies: Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. ...read more
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was ...read more
Genetic Strategies: Knockout Validated: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) ...read more
HIF was not the only factor stabilizing activated EGFR in VHL-deficient ccRCC cells.A. Western blot analysis of 786-VHL and 786-mock cells stably expressing shRNA constructs. For HIF2 alpha and HIF1 beta analysis, ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 30993183). Feline reactivity reported from a verified customer review. Rat reactivity reported in (PMID: 30101191), also customer review.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Konopleva M, Yap T, Daver N et al. Targeting Oxidative Phosphorylation with a Mitochondrial Complex I Inhibitor is limited by Mechanism-based Toxicity Research Square (IHC-Fr, Mouse)
Fixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Chemotherapy-induced metastasis: An unexpected foe? By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.