![Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Western-Blot-NBP1-91684-img0004.jpg "Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNPEP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using NBP1-91684 | Applications | Species |
|---|---|---|
| Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aspartyl Aminopeptidase Antibody (NBP1-91684)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNPEP |
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0009.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0001.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0005.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0006.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining in human testis and pancreas tissues using anti-DNPEP antibody. Corresponding DNPEP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0007.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining in human testis and pancreas tissues using anti-DNPEP antibody. Corresponding DNPEP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex, lymph node, pancreas and testis using Anti-DNPEP antibody NBP1-91684 (A) shows similar protein distribution across tissues to independent antibody NBP1-91685 (B).](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0008.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex, lymph node, pancreas and testis using Anti-DNPEP antibody NBP1-91684 (A) shows similar protein distribution across tissues to independent antibody NBP1-91685 (B).")
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0010.jpg "Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human lymph node.")
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Simple Western DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Simple_Western_20720.jpg)
![Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunohistochemistry_17209.jpg)
![Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunocytochemistry__Immunofluorescence_17210.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")