![Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Immunohistochemistry-Paraffin-NBP2-52872-img0012.jpg "Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL0178 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
| Epitope | FKRRFKEAFS |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | AQP4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Aquaporin-4 Antibody (NBP2-52872)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AQP4 |
![Western Blot: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Western-Blot-NBP2-52872-img0013.jpg "Western Blot: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Analysis in human cerebral cortex tissue.")
![Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Immunohistochemistry-Paraffin-NBP2-52872-img0008.jpg "Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.")
![Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human cerebellum shows strong positivity in neuropil, mainly in the molecular layer.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Immunohistochemistry-Paraffin-NBP2-52872-img0009.jpg "Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human cerebellum shows strong positivity in neuropil, mainly in the molecular layer.")
![Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human stomach shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Immunohistochemistry-Paraffin-NBP2-52872-img0010.jpg "Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human stomach shows moderate to strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Aquaporin-4-Antibody-CL0178-Immunohistochemistry-Paraffin-NBP2-52872-img0011.jpg "Immunohistochemistry-Paraffin: Aquaporin-4 Antibody (CL0178) [NBP2-52872] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")