Novus Biologicals products are now on bio-techne.com

Apolipoprotein B/ApoB Recombinant Protein Antigen

Name: Apolipoprotein B/ApoB Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38608PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Apolipoprotein B/ApoB Protein (NBP2-38608PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Apolipoprotein B/ApoB Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOB. Source: E. coli Amino Acid Sequence: NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	APOB
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38608. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein B/ApoB Recombinant Protein Antigen

Apo B-100
APOB
ApoB-100
ApoB-48
apolipoprotein B (including Ag(x) antigen)
Apolipoprotein B
apolipoprotein B-100
apolipoprotein B48
FLDB
LDLCQ4
mutant Apo B 100

Background

Apolipoprotein B (apo B) in human plasma is a major protein of low density lipoproteins (LDL). The molecular mass is 260 kDa. Apo B binds to specific receptors on cell membranes and is involved in removal of LDL and very low density lipoprotein (VLDL) cholesterol from circulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LDLR Antibody
[Unconjugated]

AF2255

Western Blot LDLR Antibody [Unconjugated]

(45 Publications)

Species: Mu

Applications: Block, CyTOF-ready, Flow, IHC, WB

Lipoprotein a
Antibody (4H1) - BSA

NBP2-37477

Western Blot Lipoprotein a Antibody (4H1) - BSA Free

Immunocytochemistry/ Immunofluorescence Lipoprotein a Antibody (4H1) - BSA Free

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Apolipoprotein
A-I/ApoA1 Antibody - ...

NBP2-52979

Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free

(1 Review)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Thyroglobulin
Antibody (2H11 + 6E1)

NBP2-34294

Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)

(3 Reviews)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P

MTTP Antibody

NBP1-62489

(1 Review)

(1 Publication)

Species: Dr, Hu, Mu

Applications: WB

Apolipoprotein
E/ApoE Antibody (WUE- ...

NB110-60531

Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

(2 Reviews)

(38 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Soluble
Liver/Pancreas Antige

NBP2-20454

Immunohistochemistry-Paraffin Soluble Liver/Pancreas Antigen Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Lipoprotein
Lipase/LPL Antibody [ ...

AF7197

Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]

Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]

(11 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

Fibroblast
Activation Protein al ...

DPC900

(50 Publications)

Species: Hu

Applications: ELISA

Apolipoprotein
CIII Antibody

NB600-610

Immunohistochemistry-Paraffin Apolipoprotein CIII Antibody

(1 Review)

(2 Publications)

Species: Bv, Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

LIPC Antibody -
BSA Free

NBP3-04922

Species: Hu

Applications: ICC/IF, WB

CETP Antibody
(ATM192) - BSA Free

NB300-558

Western Blot CETP Antibody (ATM192) - BSA Free

(1 Publication)

Species: Bv, Hu, Rb

Applications: ELISA, ICC/IF, IP, WB

Complement Factor
H Antibody [Unconjuga ...

AF4779

(1 Review)

(2 Publications)

Species: Hu

Applications: IHC, WB

Metallothionein-1B
Overexpression Lysate ...

NBP2-10437

Species: Hu

Applications: WB

CD55/DAF Antibody
[Unconjugated]

AF2009

Immunocytochemistry CD55/DAF Antibody [Unconjugated]

(8 Publications)

Species: Hu

Applications: ICC, IHC

Apolipoprotein
B/ApoB Recombinant Pr ...

NBP2-38608PEP

Species: Hu

Applications: AC

Publications for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

There are no publications for Apolipoprotein B/ApoB Protein (NBP2-38608PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

There are no reviews for Apolipoprotein B/ApoB Protein (NBP2-38608PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein B/ApoB Products

Research Areas for Apolipoprotein B/ApoB Protein (NBP2-38608PEP)

Find related products by research area.

Blogs on Apolipoprotein B/ApoB

There are no specific blogs for Apolipoprotein B/ApoB, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.

Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
NB110-60531

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Apolipoprotein B/ApoB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

APOB

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Apolipoprotein B/ApoB Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Apolipoprotein B/ApoB Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Apolipoprotein B/ApoB Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

Reviews for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

FAQs for Apolipoprotein B/ApoB Protein (NBP2-38608PEP) (0)

Additional Apolipoprotein B/ApoB Products

Research Areas for Apolipoprotein B/ApoB Protein (NBP2-38608PEP)

Blogs on Apolipoprotein B/ApoB

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics