![Western Blot: AMICA/JAML Antibody [NBP2-14286] - Analysis in human lung tissue.](http://images.novusbio.com/fullsize/AMICA-JAML-Antibody-Western-Blot-NBP2-14286-img0009.jpg "Western Blot: AMICA/JAML Antibody [NBP2-14286] - Analysis in human lung tissue.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | JAML |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 12/15/2016 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Immunohistochemical analysis of paraffin embedded mouse kidney tissue using control rabbit IgG (left) and anti-AMICA/JAML antibody (right). Image from verified customer review.](http://images.novusbio.com/fullsize/AMICA-JAML-Antibody-Immunohistochemistry-Paraffin-NBP2-14286-img0004.jpg "Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Immunohistochemical analysis of paraffin embedded mouse kidney tissue using control rabbit IgG (left) and anti-AMICA/JAML antibody (right). Image from verified customer review.")
![Immunohistochemistry JAM-C Antibody [Unconjugated]](https://images.novusbio.com/images2/JAM-C_AF1213_Immunohistochemistry_10165.jpg)
![Immunocytochemistry JAM-C Antibody [Unconjugated]](https://images.novusbio.com/images2/JAMC_AF1213_Immunocytochemistry__Immunofluorescence_17388.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
![Western Blot JAM-B/VE-JAM Antibody [Unconjugated]](https://images.novusbio.com/images2/JAMB_AF1074_Western_Blot_21290.jpg)
![Western Blot JAM-B/VE-JAM Antibody [Unconjugated]](https://images.novusbio.com/images2/JAMB_AF1074_Western_Blot_21369.jpg)
![Simple Western JAM-B/VE-JAM Antibody [Unconjugated]](https://images.novusbio.com/images2/JAMB_AF1074_Simple_Western_21685.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
