Home » alcohol dehydrogenase 4 » alcohol dehydrogenase 4 Proteins » alcohol dehydrogenase 4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

alcohol dehydrogenase 4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for alcohol dehydrogenase 4 Protein (NBP1-90233PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

alcohol dehydrogenase 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADH4.

Source: E. coli

Amino Acid Sequence: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADH4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90233.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alcohol dehydrogenase 4 Recombinant Protein Antigen

  • ADH-2
  • alcohol dehydrogenase 4 (class II), pi polypeptide
  • alcohol dehydrogenase 4
  • Alcohol dehydrogenase class II pi chain
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Background

alcohol dehydrogenase 4 encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Amphiregulin
Antibody
AF262
Neutralization Amphiregulin Antibody
Immunocytochemistry Amphiregulin Antibody
Immunohistochemistry Amphiregulin Antibody
(1 Review)
(35 Publications)
Species: Hu
Applications: ICC, IHC, Neut, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Sorbitol
Dehydrogenase Antibod
NBP1-87416
Western Blot Sorbitol Dehydrogenase Antibody
Immunohistochemistry-Paraffin Sorbitol Dehydrogenase Antibody
Immunohistochemistry-Paraffin Sorbitol Dehydrogenase Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
Aldo-keto
Reductase 1B10/AKR1B1 ...
H00057016-M01
ELISA Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Immunocytochemistry/ Immunofluorescence Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Immunohistochemistry-Paraffin Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
(14 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
ARIH1 Antibody
NB100-1162
Western Blot ARIH1 Antibody
Immunohistochemistry-Paraffin ARIH1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
DCXR Antibody
(OTI7D11)
NBP2-02192
Western Blot DCXR Antibody (OTI7D11)
Immunohistochemistry-Paraffin DCXR Antibody (OTI7D11)
Immunohistochemistry-Paraffin DCXR Antibody (OTI7D11)
Species: Hu
Applications: IHC, IHC-P, WB
XPR1 Antibody
NBP2-48531
Immunohistochemistry-Paraffin XPR1 Antibody
Immunohistochemistry-Paraffin XPR1 Antibody
Immunohistochemistry-Paraffin XPR1 Antibody
Species: Hu
Applications: IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ST3GAL4 Antibody
NBP1-69565
Immunohistochemistry ST3GAL4 Antibody
Western Blot ST3GAL4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AKR7A2 Antibody
NBP1-32828
Immunohistochemistry-Paraffin AKR7A2 Antibody
Immunocytochemistry/ Immunofluorescence AKR7A2 Antibody
Western Blot AKR7A2 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
alcohol
dehydrogenase 4 Recom ...
NBP1-90233PEP
alcohol dehydrogenase 4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no publications for alcohol dehydrogenase 4 Protein (NBP1-90233PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no reviews for alcohol dehydrogenase 4 Protein (NBP1-90233PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alcohol dehydrogenase 4 Products

Research Areas for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Find related products by research area.

Blogs on alcohol dehydrogenase 4

There are no specific blogs for alcohol dehydrogenase 4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alcohol dehydrogenase 4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ADH4