Home » AKAP12 » AKAP12 Proteins » AKAP12 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

AKAP12 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

AKAP12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP12.

Source: E. coli

Amino Acid Sequence: QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89168.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AKAP12 Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein (gravin) 12
  • A kinase (PRKA) anchor protein 12
  • AKAP 250
  • AKAP250250kDa
  • DKFZp686M0430
  • DKFZp686O0331
  • FLJ20945
  • FLJ97621
  • Gravin
  • kinase scaffold protein gravin
  • myasthenia gravis autoantigen gravin
  • Myasthenia gravis autoantigen

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed in endothelial cells, cultured fibroblasts, and osteosarcoma cells. It associates with protein kinases A and C and phosphatase, and serves as a scaffold protein in signal transduction. This protein and RII PKA colocalize at the cell periphery. This protein is a cell growth-related protein. Antibodies to this protein can be produced by patients with myasthenia gravis. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Neurogranin
Antibody [Unconjugate
AF7947
Western Blot Neurogranin Antibody [Unconjugated]
Immunohistochemistry Neurogranin Antibody [Unconjugated]
ELISA Neurogranin Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
AKAP1 Antibody
NBP1-89172
Western Blot AKAP1 Antibody
Immunohistochemistry-Paraffin AKAP1 Antibody
Immunohistochemistry-Paraffin AKAP1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(682 Publications)
Species: Hu
Applications: ELISA
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AKAP13 Antibody
NBP1-89163
Immunocytochemistry/ Immunofluorescence AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FAK Antibody
[Unconjugated]
AF4467
Immunohistochemistry FAK Antibody [Unconjugated]
Knockout Validated FAK Antibody [Unconjugated]
Western Blot FAK Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKAP5 Antibody -
BSA Free
NBP2-92794
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Western Blot AKAP5 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Angiopoietin-1
[Unconjugated]
923-AN
Angiopoietin-1 [Unconjugated]
(71 Publications)
Species: Hu
Applications: BA
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB

Publications for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP) (0)

There are no publications for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP) (0)

There are no reviews for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP12 Products

Research Areas for AKAP12 Recombinant Protein Antigen (NBP1-89168PEP)

Find related products by research area.

Blogs on AKAP12

There are no specific blogs for AKAP12, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AKAP12 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP12