| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AHR. Source: E. coli Amino Acid Sequence: NWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | AHR |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89974. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for AHR Protein (NBP1-89974PEP)Find related products by research area.
|
|
AHR - A transcription factor regulating immunity and tumorigenesis The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w... Read full blog post. |
|
Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more... AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AHR |
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Immunocytochemistry/Immunofluorescence: AHR Antibody [NB100-128] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti AHR [NB100-128] at a 1:100 dilution overnight at 4C and detected with an anti-goat DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](https://images.novusbio.com/images/AHR-Antibody-Immunocytochemistry-Immunofluorescence-NB100-128-img0004.jpg "Immunocytochemistry/Immunofluorescence: AHR Antibody [NB100-128] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti AHR [NB100-128] at a 1:100 dilution overnight at 4C and detected with an anti-goat DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.")