AEBP2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of AEBP2. Peptide sequence: PEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLK The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AEBP2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for AEBP2 Antibody
Background
DNA-binding transcriptional repressor. May interact with and stimulate the activity of the PRC2 complex,which methylates 'Lys-9' and 'Lys-27' residues of histone H3
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Av, Bv, Sh
Applications: WB
Species: Bv, Ch, Hu, Mu, Rt, Ze
Applications: IB, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for AEBP2 Antibody (NBP2-86960) (0)
There are no publications for AEBP2 Antibody (NBP2-86960).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AEBP2 Antibody (NBP2-86960) (0)
There are no reviews for AEBP2 Antibody (NBP2-86960).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AEBP2 Antibody (NBP2-86960) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AEBP2 Products
Research Areas for AEBP2 Antibody (NBP2-86960)
Find related products by research area.
|
Blogs on AEBP2